ELF;H4ih4 (44BBDD>>tL/usr/lib/ld.so.1ol !#$%')*+,-./13567:;=>?@CDFGIKLMNOPQRTUWY[\^_`acdfgiknpsuvwx{}~    "#%&')+,-/012679;<=?CDEHIJLMNOPRSUVWYZ\]_`abdefik  "&(02489<ABEHJSVXZ]behjlmoqrtyz|  !$(*.3458:>@ABFGKQTX[^cghj  p0  .Xp 8d Dh RTY` l@t  zL \L0 @  x "H      H # 4Xh E3\  Vl@ bP p1  x~D x,   ݸL ? h   d /DL DH L -8L ) 29T G,S_0 n  }Xd X 4 g   > BT  B ;H   #X+ 6H=Ep Y{ n?Hp ŀ p, A B`l h D$ 0$  @h "((t1 : OV@ ` jh y4 ) VP x ' (\ x DX P P( -@5<CT Q< j{ $ 0TD  L DX L Ԭ D&x 2t X, P%$ 34 <EQY`_Le@( r(yC   H  x  D< DhA  /TX A V.( d8o!P uc HH<@`  < Cx (  ì '#, 3@@ @@@ @Ԑ @AȒ@O'@@Ӑ @ @@͐ @Ԑ<@A@O L@@ @P@@ @Ԑd@A@N ؀ F@Ԑt@@ F؀Ԓ@AG 'ܒ@ +' Ԁ !@@ @̱@@{ @̵Ԑ@A_@N@@i @̙@@c F؀ F F@̊ @@T F؀Ԓ@@  @ +' Ԁ "(@@8 @h,@@2 @lԐd@A@Nu@{@i<t$MF @̉ ['܄"ܐ @̂ ]ܶ5"4'"@@ /@@Ԅ /(܈ I . /(I ( *I (F@@ FF@@xF؀@@? @`* 8'F؀Ԑ @@cܐ@ܶ   TF 9GԀ 7@@? @Ȑ@? @̐ԐL@@v@MՐ\@? @˱`@?{ @˵Ԑ@@_@M@?j @˚ @@@˝Ԑ@@G@M؀ `@ˁ@?K `` H @t@?> F` F"M@@!M/3 '@ˋ@ˈ`    ?#h'77Ֆ@˫FF@?$F"ՐP@?6F@W ?#h@tL / [,  L   ]I  ./") I  2I  ]) ) FF@?F"Ւ@?FcՐ @?m@    WF ;]Հ 7V@> @Ґؒ@> @֐FՐ@?@Lސ @> @ʺ$@> @ʾFՐP@?g@LƐ`@>r @ʢd` @? @ʥFՐ@?N@LcF@ʇ@>Q F@ʀ@>J FЄ`G' E` A` FЀ" `$2`$`$@> `$@ǔ !'܀ Հ Ւ@> @OȒ@> @SՐ@>@L\܁ ` @6@> ` ]' Ւ@= @  '  T  Հ &D5Հ 7(@=Ր @,@=ϐ @ Րd@>@Lt@= @x@= @Ր@>@K@= @א@=  @= @̐ܒ@=  ? ((0' %'G@ɽՐ@>g@KƐ@ɧ @`@ɰ @>䀤Ԡ    @ɍ,@=W  Ւ8@=L @      QՀ ieՀ b  " jՀ 7H@=  @PL@= @TՐ@=@K[@= @7@= @;Ր@=o@KB@< G@-Ք@= @ Ր@=ʒT@K'@<Ӑ @G@@=z @ @< @@< @֐ @=)@J @ؐ0@< "֐ <@=E@    d   E"9 7>P@ H2@D? א @:@ @9ؐ  @1?` 2@א$@:@H, *( *@[ @=4 G@8@:Z  *@e@  @:O@@e@$ *ӐӒ@ŵ ӐӒ@ŭ ڄ`Ӓ@Ŧ ڀ`Ԓ$@ş `(Ԑ,Ԓ<@ŗ ?@@ŋ F@F@F@FՐlՒ|@}!g [@žF@źB@Ŷ @Ų@Ů @Ū@Ŧ$,,$,,,,$,,$,,,@$$,$$,$F@[&F e@c\ e@D@9  "(@c"@@2@@  `  $``7  ;<`@S`$``$`@G"``$`$`@F"``$``$``"``$`$` L"L`2L@b"Lx@-2L"L ` $`@b  Ā @]e h@p @Ď|h@טh @9@Ī "'d 'ddd@F2``$`$`& 6(@Rΐ̀ " d% @R̀"T̀P@FZ" ,`" ,@C`ԀאP@8`@FL , @ad @@P  @``@"`Ԁא@8`@F+@ d @8Ā2`Ȁ2`@\ƒ dג#\ @8o@` . @RhdȄ$' @RadȄ$ Ԁ@8@̐4 @8G@A G@הD@8:  "``$` "$` "@ 㿠-$@`&``&``&`@Zd@b^`@þF"&@@Ìl@8E&@ V " &@@@ ɐ&F&F@ G@|ה@7  @c @7ޔ@Ç`&`㾀,0 0FF0`耠 ,@>,0F@7,0  0 #`'&2&&&@E32&`&`R "9($;<@QC,@ " @_$ @V@YÐ$@쀠"D  2@ @@fx2: @  @    "   @ ` @̐@ @7F   @,@@7<   @¸h @73  {`"l "P"z W`  @˜@6b q @@)@¸ "״   ?#`'@@ @耐 ת @m@ @6 D @d@ @6ސ @@ @@? G@cה@6ΐ ג@6 ' "%  2 @: @6  "   @)8 @6  2 P""  " `" @`T@" T  XT@"  @`  2  @\@@6r  " 2 耥`"@@W  אx@6@@@$@@U@ 6  `$`  0  0 6F F,06 @",,耠 ,@,0F@6T,0  0ג@$_'㿘3Fc"m خ׬@Pb`2[`@ @`$  ?#`L L /L  `@c`А@c"c@6c`@5@`  @8L @5`&@^ @U@ @U@J``  @8  6 "㿘`$`Y ""F'$F(" $"@_@@5_ @D2 $H12."  $ ? @$2 $?G@$@ؒ@5( ?2@% 0E2 `@ $@5  $` X@@O! "2 6~$`(@ @~ )F"@@B ؂@ ` ` ` $Hd ""耠`؂@Ԃ@ "~Id@]+d`@]"@VԐ@`@  '耠#dL?@@|@`@  @4 @ @4~@'Ԃ@@y`-j $ 2"耠2 ؐ@     ؂@Ô" ""`$`@@A֐@@` ؂@@4g``@ϐ ``@ǐ㿠  @  @ @$"$`$㿠 @  @ @`2 㿠@\/ (Ѷ&`9F (  '#ز  $ `,@\#$`$"& & H`( @AX& & H`( S`H  ˀ` ($ #`H 2#`(#؀`@3   ؐ@3`  `H( `H( `H( `H  F`P@^ ,   㿠 @ @@[`777ؠؒ @F؀ؒ,@ ؒ4 @3"ؒ<@2j FؐT@3M㿘% @H2@ @ؐ`@ @ 7@ @H22H@ 3 @x -, 4 @r`@w`*`- ,@`J0&I J9,`I  ( 0I 0I 9,`I   @ @7 @3ؐ5@0 䥒@$ 7@  @H2@ @  㿈7Y >   ?#h#`0#\   @# ؐ@ Y@ؐ 7@ԐA @H2@Ð @ 㿘ؐ @ .@ 7@ @H2@ 'H"I Hцa(2I  I  I (" I   &.@ђI ( @(I  ( 0.@I ( 2@I ,      &.@@O @K &㿘/ؐ/H@C 㸒@7 7@3 @+H2@" @ 㿘@ ㍒@  7@u @H52H@ 2@ @ 㿘9@_!ؐ@ V@Ր 7@ѐ> @H3@ @ 㿘@ +@ 7@ @H52H@ 1@ @ 㿘@ @x 7@t @lH52H@c 1@\ @X 㿘ؐW @R ǒ@F 7@B @:H5@1 @ؒ@ @9䀐 &`ؒ@0&`@(  &`ؒ@ &` &`@ 㿘ؐ @ p@ 7@X @H5@ڐ @5ؒ @1 `@`@X&`@ 㿘Ő@ 5@& 7@ @&H5 @& !G$! @ &!@& @ 㿠ؒ@ N  N ҆`(8 I㿠@h    ,`L x  L s L  L  L  rw`?(`?( @,`㿠@:  H 2I " . H 2N .N  L  ", L  2L 8#`P@8 #\G@ؖT @/T #h@Z#deѮ,<#tb\@ @Kd@?2'@ڐA'J - 7Fd" l"   '"$`@/Th`'"`@/Jt`'"`@/@ `'"`@/6`"! !!'''"#pؐ@/#p  '"#p@/#pغ?#l @Ր      a`C @:  & '$`L( L $  0@耤 '/`(L (2L  ؅,@.؄ #l䀧``L`" L`L` 0(L`( 0 0yؐ@.sm`L`    (K L`(- L``( 0L`(- L`:3 L` (`-`I  ( 0I (-`I : I ( -J  ( 0J (- " ؐ@.?؀ؒ@.4 c@ ,`@t$@   ,@ؒ @#t #lr@V? #x'􀠠"tؐ@.xt(ؒ$@>Sؒ(@8"N@c @U'@(< H / ("=@-֐H8䀡 H @ ("+@-Đ`&䀡 2#IH *2("@-x #l  @-, #p䀠 2 􀠠2 #l"l@-lJpGd2h@U #d#h@ $   $ '@U $  #h@ $ @ '@ڐ' '''' $   '''̀l&'Є l''Є?''@ h @"@-8䀠"@􀠠@@@X\@\d@؝Xؒ@ G@fؖ @,Д @Xr  9 (@U0`'7F'ؒ@,ؒ@@ ج @ @ذ@ @ Fئ d@ @آ@ @` " N`P"`   ؒlД@,'?''''''''@'쀠ْ@,ْ @n J  ٢@e J H< '!'' @, '@['!' @,r  '@T| @ %  % '@Tq $@ $@Ȑ@WR@㿠N  R ,",`D"`E" ` F"`W"`F    " @,,8 L 2L Pْ@ G@oٖ @+ٔ @W{  @z@Ws@s@Wl@l@We,l)zْ@)F#ِ@+L "HL ; HH;2H;"(@:ِ$@",@S#'䀠"L@+L  '#'耠"'@+ '#'"'@+'ْ@h 2/##@+@@VْL@O##@+v@#@+kِP@+bْd@- #ِh@+V@2٬t@ ̠  @  &*@ < 8 ( ($ْ@ @ #"'l#`@+&٦  @ @O`"L O`:  L L :2 L "L  @L "L L :  L L :2 L "#@ʐ #" '`ٔ#\@*ޚ'?''''''''@#'쀠ْ@*ɐْ@ ْ@ ْ @  #@*@ (_#'ٔ<@* '@R @ؔ &  &'@R &  @˔ & @@U#@*{x@@@㿠` ``*, ـ`%% T@ G@ٖX @* @+@$0 '  @~`@)  㿠7FTْ@Ő G@xٖ @) T`(5@D`(`,  @D`,  @y @v@R 77 7ْ@@Z  @U@Rْ@ْ@~@` `` @uْ@q@4` `` @hْL@d, 7D /ْ`@W`  @!`  l ( d@F   p @=`ْ|@7`@Ӑ@0` "ـ"@@@@@@@Ȓ@ @Z`ٴ ؐ@ H/  |$$( @ H  o$$(ْ@ܔ`  c$$(ْ@˔`  W$$(ڒ@` @U@VZ`@`2 ``@ 3$$(@]``7ڒ@@ST@@  /@ِ /@ِ /@ِ /@ڐ @ѐ:` @ ; +  "@ J  `* J @J*  ` 2  ?#:  㿐 . @ @ؔ    Ք  @ ,8/ɔ ,* ̒@ N  N  N  N  "  .  *  @ L  L  L  L  " ,   * @w L  L  L  L  " , ! ] * @T L  L  L  L  " , , : * @1 L  L  L  L  " , 7  * @ , Fڐ4@'Œ㿀@.;  ?#`@'@$ ?#`@@@@.*@@.'@.,''@ϔ  & @. @.@.''@ $ 9Đ͒ J ` J@  J`2J    J   *` @ &K 㿘!9'4##` (`` ?#`(ߔ# (#(`(Ԓ`Є# (ʔ# `%`$#㿠4 '4Ъ19# 2 # $$$&#N- $#N+$ #@ِD"$$##􀠠"#H`22" " "$ЀЅ(H-2 Ѕ(H Є$Ѐ&$Ѐ"%Ѕ(@T2Є$" "J $2$$$$Ѐ2 "ʢ?$Ё?(H-2Ѕ(H`  Ѕ(H-  Ѐ`(&#"(#Ѕ(H-2!#Ѕ(H-`"##  #\ HH= `L`L`=2``# ##$@@2@#$@ 2    #\ `2#`\4Ԁ@CXG<Ѕ(G@h@e##&#Є$Ё ? { Є$L`"7  `4\ 4Ԁ$Ѕ(H- @xG<Gh@i @G<Ѕ(HGh@X @###&# ?+Ѐ 4І$Ѕ(4 Ԁ@ېG<Ѕ(G@1h@##&#M:Ϣ ? :@##& "     4Ѕ(H- 4#H2/#4Ԁ#7Ѕ(H- @G<G#@h7@ G<Ѕ(HG#@ߐh7aL&#Є$Ё ?&#H’#H Є$N`:M4J :hJ :2##H 4# Є $&#4 &#H 4# Є $%&#Ѐ4Ԁ 4@5\G<Gh@4 M:2  ? : &#І$Ѕ(4 &#4Ԁ 4@@G<Gh@l4 ؁ ?2Ё?$Т (4 ́    њ В  ``G* *`  㿠@L " " $  ( 88$ $  @L($   (@ϒ 㿠@ @܁㿠   @R  * -   @ 2   㿠ؒ 2 㿠͒ ` $ "  $`  㿠@ 㿠   ( n(* &  88&  @L( (@\ @(& ,  " @ *    *@I㿠    @ * -`  ŀ 2  $ $  & $ $   㿠62   ( "    &  ,  @o * 2   %  2  㿠  (@ & 㿠   ("@"2* J ` J   *`" J@J *` 㿠@U " 㿠| |v XJ јc `J *`" J @J *` 㿠@l " 㿠| |K!㿘@J P&` P   O@$ `,@Jݒ&`$"& & H`( @0& & H`( P `H 2͢````H `@/"< ?"9 O "` "-``` `цaH(@ $``  `H(@2$` `(F"  ڐ@"P` @" 㿠N`"I N ђ N` 2I  I   J  I  " I  J : @>@ 㿠N Ѣ (@,L``( 0L`(,@ @L@"&`  㿠@J&`  "` J "J` " J` "J` J "J "J "J ""  "` "㿠 @  @ ,`@ ڒ@ܔ q 㿠2`  "  ( @-``?㿠 @  &   6& ڒ@  㿠@I|    ` ``%`%`@Ih,`%` `%`   ` @  &`ڒ@{ %`㿠@IE  " " @I? $ $  @i 㿠@ @㿠 #F & c"  ڐ@!  cڐ@!㿠 #\@\㿠%92`  $` &` @I.Fڨ8ڐ(@ ޒ``  ֐@ ѐ`&`@ ɑ<㿘@ ?'9kF" ڐ@@  $ ` @ݐl @ X@`2 @ϐG@y@@ F  @@ < z㿠 F4 44@! 2` ` `@   ڐڒ@!6F㿠@ -Ѥ @@? ?L`H ?  "` & L  ,ۀӮL #5$@ "MM("M M((L  ( 0L ((: ,L (2M,` ڒ@ `L ;" ,`" ,L (`, v` ڒ@Ô `L ;" ,`" ,L (`, Y` ڒ@ `L ;" ,`" ,L (`, <` ڒ@ `L ;" ,`" ,L (`, `*&Mڒ@k 2ML ;" ,`" ,L (2M, L ;  M,*L , @ ,``& @&,`@" @F% %@F@%% %@%7 @ ,``& @&,`@" @Fu% %@Fe@%% %@ )%HшH(H2H㿠 "  &@*   @  2      l(L㿠  N ц 쀤"  (!2 L "- $ (L! "L "L  "" '"  "z >"  sqo(2i ."f -"c _"`  ^ ( ." L-" L_"L MLI',"Lڅ,L 8<2L 63@L +-?L #-2 L -2L --L  - L U" ڒ$@o!,4ڒH@h!LXڒd@a!Ltڒ@Z!L@'  ' #''`'`!'!#'`' ''''$@ <   @J !2 J 2'􀠠/ @۴ L`(2`L`." `L`-"`L`_@`@L`(2`L`."`L`-"`L`_"`@"'L`(@ `@L`(@2`"L`>2l      L`'(@"L``@xL`(@2`L`/2L``@iL`(@"L``@^L`(@2`L`>2YL`>& L`(L`." `L`-"`L`_`@8L`(2`L`."`L`-"`L`_"`"(L`(@"L``@L`(@2`L`(L`.L`-L`_L`/~L`>zL`=2`@L`(@"L``@L`(@2`L`""+L`L`'&L`(@@L`>@`@L`(@@L`>2`@"'Ą '''8 L`'`@ H"L` L`   L`"`L`>" L``@L`ꀠL`2''Ģ`@ '' ' '' K ` -  & &- -` -  (@Cq' @C`(( (@''-` ($ i $ b$ Ȅ $  "`@*,'$'Ѐ`''$'ܐ   !  !  &'ܠ`''* '􀠠2@m' '''@`㿠@B T3:4&`1F `  #@#@ #@`#@ @S #@2#@` `2#  @7 `2 "`  `  &`,  @B 4ll " ` *`(  !4   ` %@ `@&     .@B~""`` ݬ '㿠4 ܤ@Ւ 4 ?``*?㿠    @   &  ,&  ( 㿠@6I  ` `(/F @ @G  @ @74 3F"m  @ @=1F# ۔ 0@ژ@7 # P@˔@8 @4Fېx@`@Aɐ  @  %.%  ( %  %.` ( -L`/ @-  "   - "'   ' ' 㿠4|?  & = 7.` (  `6%@2! @@2   &  ` ` "  & ے@i! 㿘۔#  *  * "@}@= &@A5&㿘۔ ې @p"  ے@i   㿘ې ۤ sѦ@Gmےy J ("I ,I  ( 0I (,I ;I  (@" J  J (@2 J ҆`UkJ ReJ L_J =[J  (@" H(@2 BB * " 9ے@Ӑ2ې *@Ē &Lۦ @ , @@$@&L㿠 ? ,4`ې$ے0@<"\,㿀@C G@Hۖ< @ -F/: "ېD@ߒ`'''''F'''􀠠2\\@"&耠@@C㿠:"?@??@ 㿠ې&`t@  ?N ѐ ( "I *`I  ( 0I ( *`I .TR I ( " J J J  ( 2J J 2>?";?`6J ?( "0?J ( ")?J ( ""?J  0( (J ( 0((J  0J    J 2 ? &`&`?㿠ې|@  L :" +L L ѐ(  L ("L (L  ( 0L ((L -G L (@ $`  L ("I (I  ( 0I ((I /2$ I (" $` I ("$`( I  ( 0I (($` 㿠@k &` &` 㿠@ ;@I?цa(@!  I?(@2! @>ϒ$` 㿠@ &` 㿠%: $`F-$F@A袘㿠.`):6`.`0  􀠀'@}F@&] $4 $% F۰@ ېے@@!iے@9!n4㿠:.` 6`.`0 & 2 D  }@F@Ȑ8s  㿠 " @*  " @$   @  & & & ~ 2',?'F||' # ####' ?'`$$$ $$$#2# (t0"@h @% :d"!ې@W #;  (0Ȕ 1 #`G7P# 7 X#("@(   ?@ ۶@(7\#7p# F@B   ?@ ۸@F!7@pt   ?@ #@t (@d p   ?@ # p@ (' ,' @u 쀠''耠''    @ Ģ @3 @ '@` $" `(("`($(#`,#    ېԴ @ @0   @B   ?@| ۴@) G7tG$ `    `@< ##@34##"#@ΐ##`"#@ǐ##"#@## "#@##`"#@##"#@##Ā F@#Fx#@#@@@@ @Ą@{Ȓ G ?@ Ѐ##`7`#7##7# # 7#`#`7##7# #7#F#Fx7#7 #7#`#d#\#h#p#l#t#|#x# @IF`ܐ<@`@ @ @@@h`7#7#@ @-'?'Ю @? % @   Ђ@̂@t < ̂@`H4 ܒ@M @}Ȓ@G ̂@@`@@@qd:ܐ@:" :@2  NF܀̂@@t``@;̐@``@3 ..Ẑ@`Ȃ@P$?2Ȃ@`H @\@;$F@;$FF؀ ܂@p` @܂@x` @ŵ@`H @0@:$ @D@:$̂@@`܂̂@`HF؀"  ܒ@I䀠F䀠2܂̒@}`X.䀐܂̒@`܂̒@}` ܂̒@}` {਀܂̒Ă@U`k܂̒Ђ@}` ޖ[܂@`ĔT@˖Ă@`A%<܂@`L@ﭖ" @`$ 􀠠܂̒@}`$ ܂̒@`0̂@@2`k@.ܒ@͐ 䀠"􀠠"Z # ! (0c!ZW"'@'Ґ@ސF:ܐ@@:" :@2(+@ ܒ@  цH(@H܄ '#@@h@c  5@P@[ @ 5 @'  !-!,!-!-%!.!,2 !,2.2*%@ؔ@̀2%%-),@ .@䀐ܒ@z,@b,@9 , ,@y %2o܀"n$8䀠"6$&2$@@ڐ $$ %@+@&@d:ܐ8@:"M ):@2H )N )$"0$@ݐH,@W @@@Ԑd:ܐ@~:" (:@2 ( (@M  䀠'?$T"G"C\2?@ؒ@` 䀠"h@=@W "@@= @ @u @o @8ݒ@ ݒ @* "'@'"$2$؀2C,@0ip",@07$,(,@;G@<,ݒ @ @-d:ݐ(@ג: :@x"m @5 ):G0 ):@f@g@h ` ,` ):` " @ Є #`@#\@&$  2-@אd" ݐ8@ "@2$@d" ݐH@k " @2؀@@?$ " @ 2 * $ @@@d:ݐ@0:"І *:@2ˆ * *@@@cd:ܐ@ :" /:@2 / /@<@57 @, @@.d:ܐ@ؒ:" :@2y@5"h @0 ܒ@ ͐ @G@@t ̂@@`@@@d:ܐ @:"6 !:@21 !7 !@ʐhG@@A @ɐd:ܐ@s:" 7:@2 7 7   Hے`@"i'ܐ ܒ8@$A H,,H,,pp,,H,,HH,H㾰' ' G'$$??"'``" '`): 2'`Ƨ` % '` @y * @.X@   '(@/&'(@/''('('@5'$ ?#h'(~耠/@7<+ @@ p $@8"@ݒ@ܐ2$" "@ " 4 ',Ā",($@ݐ@ D@02,' ',,2 @"D2' t   '  $@'O@6 ~" ~@1W 4@גȀ @Ԓ4@ݘ4 @ @~ `"$$'4"'@6"'D@ǐ2 'X< 2't''4 Ԁ  ' 4`2$̄$̐7((@5 ܪ@4'`& c92(~@&u~"@!ݒ@  @G@@ c ݐ"@ݒ@  @Ӑ @ O ɐ"@܀@H@ ; "܄ %@ސ %"҄ @Ԑ "Ȅ "@ʐ "`!  @@ Y @? @}В@ G =  $0 -Ѐ @^ @ S"z "@| " @LH @  @C|@  9~",~~2(~̀؀2 ~?" (&~~2~(  ,("~@5~ @" ̀°؀?W@0̐ @ r~@%d~~@̐ Д@ ^~@%PՐ~@Ր\В ̔#\@ K#\ݐ #`@ A$@%A  @3# @3"҄ "@Ԑ ""@̒ @ #\ݐ @ $@%  @2 @2z" "@ "@sԠG@~̒ @ ~@$ِ^~@^G@i̒#\ @ і~@$ÐH~"~ ,"@<В ̔#\@ #\ݐ #`@ $@$  @2 @2"9 "@; "@  "+ "@- "~ݐ@.ƒ ݠt @ s@@| @ hݒ@  ސ" %@ %@;㿘@e? '  & @]?.?'@|@R" ?   $ @J?.?  2J  `ѓ*`!@ `@" JJ `*`@ `@2J  J G2 JJ M2JJ T J +"JJ -2  J *    x'4 |@)``*?܁   $$4"J: `J@ + J * J: @J+ J * J: @J+ J ?J+  &J@ =+?+ @ =+?+?+ 㿘@J@G*  @  < ?8# `(ޠh@j ?#`@& #@1`p@V㿠@@+K@ L?籐L=?H?磐L"?H?H"LH" LL"2L2?@@1$&  ` :  6 ` `:  0*:  W* `  6 ` `  0*  W*`& `* 9:  &&' N 4 4̐6 @  i b  *`@`2:M`M`"M`M`= `M`M`=2`M`"%M`M``" M`@M`"2M`M``"M`M`" `M`M`"2`M`2`M`"M`M`, `M`M`,2`M`2`M`  "@ "@ "ɠ @  " " `" " "  " @  ?#`@@@ޒ @@  @ޒ @@Ӑ@@ @ڐ@Ő@הޒ @Ҕ@@̔@ѐ@̒ @ޒ @@@ޒ @ @@Ғ @@@@ @~@{@0#\ ޔ@@gޢ@א@Ԑޒ@Аޒ@̐"@M "@G @A㿠ސ@E N a(@21 N "- ސ @1 N a(@2 N " ސ(@ N a(@2  N    㿠ސ0@   ސ8ޒH@ ްPސ`@ ::` `;㿠4  R08, (@ː  6$?F㿠c P @!`$!T?$ @/\h$ @ $  $ ($ 8@/Sl$ @/Ox$ $ $ $!0$ $ @"$ @/$ $ #$ ؄$$ $!,$!8 $!@ 2$!<㿠@@@    @/ 㿠ޠ @ʐ J  @0\+G@/`@=@9@.Ӑޠ@j` @)  @08@ @G<Ghޒ@E@Ԑ @.ϑ㿘G/Ghޒ@0@ԐĠG@<@*-: %$@1 1@^@ @  @<@ @@ 2 @<@@1Ӓ%$@㿠 @/ 4R@rH @p\G<Gh@ɖ@@㿠ѠL "LL (@"LL L(@2LL#L( L_"L-2LL(2L_"L-"L(@$L=$ @-ؐ$``M _"  M -" M  (*M (^`?2L@` (@" LL(@2L="L@` (@ `L`(@2`@ H(@  H(@2 @-֐& ?㿠  ?@G<Gh@ * 4 b(4 㿐 @ y @zG<Gh@Ҙ t   77@@-* &@U  㿠ޒ@% N`1N` ޒ@" N`0N`" @7G<Gh@ & 㿠TPޒ @^G N`2N`? ޒ(@O"8 N`1N`"0 ޒ,@@") N`0N`"! ޒ0@1"?N`- N`1N`"?@8G<Gh@9 &  㿠@n?@ƐlG<Gh@ & 㿠ޒ@& 㿠@@,& 㿠:@:$=N`~9N`/5G 0@"N`H/2 N` (H/ N`/``M`/"`@@,0@\ /,@& @,E& 㿠N` @,~@0;& @0#& 㿠N`' @,l" `@^ $ ``H/2```(`2`@0 & @/& 㿠N` iN`n2N`N`f2 N`N`2N`& N`N`є( *`J   ( 0J  J ( *`/J "J J 'J цck "&g" *` "*` m"*` & &@@} & @@s 㿠N` N`є( *`J   ( 0J  J ( *`GJ "J J ?J цcm "2&d"*`h"*`#"*`w"*`ބ (& (@(& ( ((& ( (( &@E@   @<ؒ@ 㿠#Fbٔ2b  $ $  㿠N` !F#x"8$#x@B#x4$#x@@G<Gh@g %Fx @+x@(@@*x$xx@C@x@  (x) x( 㿠!G   F 㿘t2 F !??!?! !?!  㿠@ F@@G<Gh@ #Fc@c@*$c 㿠#Fb52b   $  㿠N` @  @*^F  @ihG<Gh@ J  "J`J`јa *  "J`* * J``" 0J`  J` *  *J`  "?? 㿠N " J N :"J N цa(@2J  J  J : J (@" J :  @L "   FcT cT@T㿠. :`0( ( "$ @ $ $ 㿠@{/:,,%-5̀%̇( (  ( @)$  $ JL@,$ BL̇((  (@@)v`$@ ($"L@ @)V $@@| ($ L@q,$L 2 %,,̄%̀6%́㿠N @  @nL`=!X = a\ Ga\`h㿠@8   F "F FԀ&Ѐ FԀЀ@j=T55Ȁ @P= P  =T@-5   @? -  @($ $     @($ $  d@% 5@ 5Ȁ @ = P 㿠b @ = P㿠!5"Ȁ =$"ȁP  $"ȁ=T"T㿐'L'P'T@'X=X1   F "F FԀЀFԀЀ  @b YL㿐'HF'L'P'T'X@=X  @C :H㿠8a8a@q= \\FG=`h \@x\@=  T@@ 㿠!=!\!\ @R!\$!\  $$  5? $rЁ㿠+5b<:): , ," 6 , ( ( @& 6 b̀,  ,b̈(( ( ḃ(( (@@㿠@)@:(Gh@ߒ@= \\@̠G@@۔ = X@= T5bЀ  "bЂǞ5Ѐ  :=!T : ":" (㿠ߒ@& ߒ@" ߐ@ @ 㿠@>G<@ߝ㿠@587@p@-lGX@@&@@!@@@}@@x@D@s@ (@n@H@i@`@d@@^ 4Plx  < t 8 p $@\ h (  D ` X T   8Tdp (D`| 4  Pl<`)G@? /% <  <2 <`% <% <9`5Ԓ{ ?v9܈ ?fd(4<Y@LRP\K`pDt=6/(4|!ung `4Y R K,0D<@=LP6X۔\/lԔp(|͔!Ɣ  $,0ے<Ԓy͒r4Ɛk4d4 ]4V4 O4(H48A4D:4P34X,4d%4yp4rx4k4d 4]4V4O4 G4@49ޔ42ה'4u&@@Ĕ444 44$4LLpd H"倠c"%c"倠k"0\"&倠r"倠vS0Ғ8%<̒HLƒX\hl| L2LN4G4@49424+4 $4x(4q04j<4cD4\X ?FG? G-FF"耠 -F """ " -FЀ2 І FԀ" %ЀFFԀF䀠+4F +4`Ц@FFF܀"@$pЀ F@a( ?#`$ `Ю(@ "`%(@#%`Ь%`&`Ъ -%F]F %F7p892L3 LH- LLHG`X$ %  9aLL9a@$  p @@0p  <   $  @$  H@ H@  @ @  Q "5F'ld3G'h"  @ " @  ,lhd@z ," h@$Gl"h@lw @ql" h@ak h"l@l @  2'l!F#F#F@ɔ`` F@ʐ#E F耠F#5GFȆ@.GFЀ9 FȆ@'@Ƞ@# F @7G@F@' G,F,F G@ fx   @  & j "" (@N Y7p@@@ST@P@L@@E@ @2 =@. q@8 <G@h@! d@+ <@L@@ @ <@  Ʀ@ސd@h@ <@  @ @@ 8F@@@ 8+4@@ <@@@ <@ِ 0F@L@Ӑ  㿠 9 b 9b9bp@@H X@    @  @Fd!=!`))G_+G %a $!`" )G@@$  ?,#9` @@x@)G@%a)G!S`"!K!   "   @  2 `"   @R`2,$ $&` # $`!  2 &`$㿠 ` @B@@@> $ @ ֐  @ $ $`J  J`*``J` 2J` 4X㿐 ''4@>#\@8G@G<Gh@5@#  +#`TGh90Ѵ ` H L (@  L  L (@2  2L L " L  L "L L (@ L  L (@2 L #L L "o L *"L L "2 L "(@L \2 V L "L L "2L  (@"L "L >L ,   2`- ")@  $`@  `9@  `b0` ``"` @G<@Z  EL @  9@ x $@t  @% 6   % @% 4@ % @Y#d#`#@ d B`ąB#\\h㿠 &@ b H & 㿠5G ? ?@   &  NXTL`2  ` @ؒ: 8   @.`  `$` `& ``@` 2` `@` %@$` $``` @`` $``6`k 㿠1G ??@ ` `2`` @: 8 \l ` 6` hd@ѐ    & `"`` @\`@X`9``@P``@` `@$9lw   @Б㿠GN  G Ip@Ր $G !? !  2 x@Ő G !? !  0 @ @G !? !  0 @ G !? !  @WGh@㿠@  @W 6$$ $@$ @_ @㿠  &  6   6 6 & #  "  # &  @  &  & 2& & @* @㿠 `   `  `&  @@  @ @@Y@@㿐   @!Ӑ@ 6  &   #`p` B ąB#\\`dD`d @ @ @ : 6#d #`d`DB#\\@ [,` `  > =(%`! 4( >( 6  ] (&( ](<:, @F $  ["$ [," ]!   <  > =  ( ( 2((뀠  ]( & @!(0@@F` ' @ #7`(#`8#\`@f\@+  D @~  $g  $c #dx d #`$h `D ąB#\\@gń < 8 , (($"""@Y < 8 -  ( $c  , P@~ T@~ c\@  d@~t@~@~  $   @~}   $$  : , ,  *,,@~\"<`d $@~T"N݄ [@~M" 㿠ǐ   㿠@~  F@~3F=  hFG@~h@~ =`@~ =hɑ@$f -6 㿠@$U -6 @~ؑ "  "  "  ?@ ?"  `Y㿠' $$ I4$H,` 㿠' `"@} && "  " 㿠@]  @} @}㿠@I " " " "  &   !F & #"#"#"    "&   &   & 㿠 `2  &  %F& `&``&`&  & "`` 0 @}N p "@ @P  z κ @  @9h9x'@  `!=!x""'!x{"'!xU@F'=\=p@g7  4 !F'"$"@ *$"" 䀢 "2 耈"䀈2 䀠 @2 @@|䀥 '' F"! " GF"" "F   "+ L!G''F  @ 8!G@L  `02$`" `0"`@"``@'@$`@``2 `@@!G  5@0F"   Ē @| @{ w@|q G@{Hj @@|"@|  @| ܔؖ@{؀@{ܔؖw28@@`@ Y " 6`" @{!TY `㿘 1F#`#TU@0" `#"#Hx#"``2#d2 `#"#4# `0 #"##Ϯ2 #"##",P`2'P`@{2!P ` 2P<" `02P @c` 2 P#"#`  #2` L"`$` @ 2 `$#"#` <̒{#H"*`@@{`h@z "`&`@`$2 `#"V#`$lO#`2 2`@{`" #"=#``6#";#`27#`@[` 2`@u @"@z`@֒ `` @ `@ϐ2##U@#" K   C 㿠@ w )@ q , @? @z $ Ę@^@\@z Ft<P@zF"qӐXl@z>"tА 㿠N  `N``N`N `  I  `J `J I " `2I  2I J 2I  "I J "I  2J /2" J /J  @y`?㿠@y =x@z@z 㿠=!xG!㿘)=!|!|2˄ %!|2!|} $!|G@y8y" !|L"!|Ȓ@y@yȐ@@ʄ!| ʮ@y@y@~@{l㿠'=||2, $|2% $ @T@QB@yO#=㿘%=||2 $|2| $| |R@yb@y`R㿠%=ppڐ $p ppɺ p@`@f$`@@㿘@ !=@`!t!t$!t!t ]    9F`s2 ##"K E գ / 0"`$ # L`" @$ $ #" `킔 0"$ $ #" s`  2 @q@ m  2 @b @Q@x@#dhd #`#\`\㿠#=a|a|"?@Ca|a|$a|?"?@:??$??􀠠@?@?$?㿠` N * $ $`  h@x  $ $`$ $`㿠@N`/"`@l &   $   &   (&  ( (@ &  (  ( 㿠  ,`    ` & ,` @ӑ(        "`"`"``   &   @x& & & p|@wҔ  㿘' '@  @wޔ   `є&@x 2 @@L`(@@`@ @L`(@2`@:L`#"@" LL(@"L# 񀤀@L(@@$ @L(@2$@֬@L`(2`L`-`@L`(2`L`-"`@L`(@`@ L`(@2`|@{FL`:v`L`(@ L(@2*  @wI `2$"J   G@w- "9`` 1Ȑ@w "#` @ `F뀒 Fu&`" ( (@y&&@v!(㿠@ G@v   `@O㿠 $    @v ` @&  @v @v㿠N N``" ҈ѐ쀢}`%8%J (1%J (*%J 0& J J 94J J  0J  7J 0& J J 94J J  0* 7* (8/% %8@ I (1@ I (*@ I 0& I I 94I I  0I  7I 0& I I 94I I  0* 7* (8/@  @2  J  I  `  㿠2  -   g   &  , ( F9 9  a 㿘@uǐ@ ?#`@u :-!=@!2!\ $!!   !X@_!P㿘@u@ ?#`@uR :,@=က2ခ ſ㿠@0@u>< &`  @ @u[" "`"@uR`&`"`?㿠@uE 㿠!=! !Pv U!$!E "!E"!@@㿠%E$$FDąB#\\$ $   Fh鑓, 鉒,  (@u($$㿠@Y F$ иЪ   ``3;20 = @uQ @$ ѐ`" ` @t ` F?bFЀ"x 쀠n@ \= G=;  % %Ҕ0 @u@t ` 2(?@ F"A@FЀ" 0 $ Ȁ Ā&?FЀ"``2 @㿐'@!997(`E#`#\`@t[\@@@?P㿘3 9`@#`#\` F\ȁ 9 D&  & FD   & Ą &@s!ɀ @s!À`㿠@s 㿠#,㿐#\  "@z\`&2&`@y@ؐ @s 耥XlF '' @ `  @ `  "P`@ `;@B#  @2p @s6$ 籔@'@А@sS 4@s%@) 眔@@s@ 4@sܐ @@@s0 4 ٦ / `+ ~􀤠%~t%~􀤠  ` @ܐ @sLT@s  %w􀠠"@r@ ~@r'@M@r@ ' Z @*` ( @:  @@rÐ@, @r  @@@)@r@r %@r|  @m@k@@r@r %@nt @V@@r@r```n"``` `  " &`&`@rV@!@ʐ& G@rGG2&@rAG0 0@r!G㿐     "@# " h&3F'5Gb' 02S@2T 6b耠" " ; "',"#@"v@q4 @r." @q( '"@qʐ"@qĐ $ 2'@O㿠@q  @q,KFЀ````@B#`#``` @   А?#`#`Fc c     c: @  * 㿠7  F ## $ ?#& @r+#@r(? ? 4??(@ , `??"8Ж`@r ?@rJ KҘ њ!J` %2J`J` "J`J` "J`J` *  !" J`J` *  !2J`J`*$` 0& J`J` 94J`J`" 0J` J`" 70& J`J`94J`J`"0*  * "7` *`J` 2J`*㿠N   ҐH H2H  @ h`N +!҆H % "HH 8 ) 0) 7)   670) )  H)  H2H!) p@p[ Ё㿠@ BJ %BJa *  !"J J *  !"C J 0& JJ 94JJ" 0J Ґ @J" 7`0& JJ`94JJ"`0*  `Ғ` * "`7 Ҕ! @ 2  @ 2  JҒ a @`"  J ` @   㿠N    "``L`$$$@(@  N V$Ң %z "L` "?L`AL``8 ,0,7, 670,,+L`L`0& L`L`94L`L` 0L` 7L`0& L`L`94L`L` 0( 7(`,L`,`L`$,@ok!㿠7$ $$@o`@o ` `2` ,7 `,("  J іa *  2 J` -"J` +2JJ *  2J -"J +"J :"J /J /"" J іa *  2 J` -"J` +2JJ *  2J -"J +"J :`?* 7"@* `(@* 7"@ * `,"㿠@oڐ J @" 㿠  :@o  "& $&@`@ &&@@n (@ x&@n (" 㿠y N N :N /L L:L/22L :/ Lшa(  I  (2   I /I @nx@  @n$ /(@ni@  @n㿠@o+@nWJ ` єcњaJ `*`@ `"J  ` @ *J`2J 㿈''  #``"  &` `7#\  ( `$( @n   #d`"ׄ  $` `M`:2`#h `"  $`  : L hђJ (  ,J  ( 0*J  L `"  $` L /  dL L ;2 L  TJ ?2 L  HJ #2 L  @mL h% `"Z  $` @ ! 0 @me 0`$ @ td$ $ $ ($ ,@ k$ @   @W $  @ Z$  `@ S$ ``@ L$ ` @ \2$ @ $  @ْ $ \"@m0@l#㿠 . 7`H4@l#K. 㿘@m  ?#`@m-ѐ@m / @ <$`@ &@ $`@  &㿠  " @l   " @l  @ @l  @㿠 " @l͐` /.`@@l " @l ;,``@@l   @l ?,``@lv㿠@ : ƒ,@㿠@l  H@ I $]"(& @l|#& @l{ @lx $@   @l< /-@@ $@l5@ (;"& @lZ& @lW @ & 㿠@lJ @ & 㿠@l> $@ & $㿠@l2 @l0 @l.  " @l(  " @l"  " (@l  (" ,@l ( ,@l ,@l @l  $@l 㿘@ 3 G@k@ L F"  H{   t Ѧ %@l  @L`(@`@ L`(@2`H(@  H(@2 6@ @1@kbm` ޖ@k@k@!  @ke $`$`$ @ 㿠  " /  @k\ @kZ`2 @kP%F@ ix ?#` ?#`@k< $x逤$@ka@k\@k $@kO @k@k N/   H/2 H/ @@k9x<F@j g@k%@ 3 G@j @jĐJ `  J`/"J`2J 㿘    H  -F-F- H /`?א &M@ L /"  L 2L @j  ?#`@j 9 H /`?9D"3 @ji @jf @    ?H#`.  H2 @ju  @j +  "M`@jB :,@ v M`H.2   HM` M`@j(@j% M ?#`/̖@jK@j " $H/"( $H $ @i @i@i@LԖ@j @jN@jK@iΐ㾠N 0`ҒJ` %  "J`J`` 8 * 0* 7*   670* *  J`* `J` *J``+" ("  ?*  N`!" " " N` F % 2/2 J`* `* *  J`* `J` *J`" :/* @)㿠%F   $H  $ 9`    H  t 2``H.`H"`@i1`@i.@Ȑ`@i^@i ``\ `耠 @#@& @U@i㿠"*:@ * : J`  "`@ 8J`   㿠N  /" @hڐ@L .2L L /"L L 2L L /  $ @h$L , .23L L .2/L L /L 2'L (L $ (L L?/ $L/2$L /   $@h$$L ,/2L L /L/"L  $@h$$L , "L L /  L L /2 L  L 㿠ޠSN`2N`@ ?$@`@h @h,N`#@hJ # @h- @Ő`@g@g,* /N`/2'N`N`/2#N`$@h5 /"J /2  @` "@gƔ@g”-N`/K $@h /  H/ $ @h /  %@ %@  %@"%@ 2%@@T` @g|"6-@gu- /    J?/    @) `@gQ`(".@gF.@l@㿠' " @gf㿠 7 ( `(( ( 7($`` (` ( , 9lU ,@g7@g4   @ G   @g# @@g @@@g@fޔ @g @fԔ @ :,@f@fƔ@ @(@f``@f`   :.`@ `  @ !-  `(@fΐ `,@f@f's (@f'9܀ 㿠 F  F㈀ @g$ ㌀ @g 0 " L " ː E@f۔$,#㿠  " 㿠@f<< ڷ   ` 2 2 @f$P @y @f`G@f% ڑ @{F耠@F@f|%G@e@f n@@f@@eG@e Z@ ?"y{q% @fr " _"1"SX@~@ 0 @, ? @h? =@e@e.@ P 0 @ ? @??D@e` |@2z ?"$  $ @e@e@ ٪@ee㿠N`/@N /R  N"NN@"NN@N2 NN/" NN@/"N N/  N@/  NN @H/`H2H@ @e,` @` ,@dД , @@e@d(- 㿘@d`   ?#`@e @d)7 )7 ?#`@d@d \  @d"   2 @e@dG@d @@ @a$  \$ % \㿘N " N   "'2N   &` $&&(@d@>@  @d`2` &&(@dӒ@dΒ㿘@p @dP ?М#`@d~   K #&    ` ""    *K  㿘G@ Ɛ@ ?+@d,`N  ?#`$@L F % 3?",`L,``,`,``L2L$@ ,`@ @c)$,`   7  7 7  7 ```d`h`l 㿘 %F2 '2  2. $' '@]N 㿠@c 㿠!F! !8 !$!㿠 @cDG< ׽@c- 㿠@d7㿠@d+ @d# Ґ 㿠@dÐ(㿠J цH(H2HJ *`:`*` :`  J  J 2J 㿠&@@bΔ,㿠FN BN   . Ѧ L , ,ڒ$`$ L(@"L(@2LL2L (h- $$ 㿘@b?' F(ᤄᤁ@bF 0@b㿐@b?' F(᳄᳁@b #\ #` l  F@@b㿠%F  @`$@cB +@b.t@b &@b&@b@c.G@c*HG@c#XG@ch@bސl@a @a 㿘''@c? G@b nx @bf#<(F֐@bN@a͐G@a C㿠@bՒ 2 @b4x" < " 㿠@aϐ@f<@aϐ@a 㿠 ې`㿘@a  ? /#`@aM /dM"MM/" MH`H/M" - @bb!?-`M 㿠@a /" @a]`@a" /,@@as㿠@aF"NN/" N! I /2N/2FF$$`$@”  `@    $@ ` `@    J "J J``"JK J @ J`  K `K J@ "J "  㿠 ")    H/  2㿠`FL /" F0 002    㿠@`@`  @J`J   ! "`"  6J` ?" 㿠 '   D   "   Ð   @`"    2   㿠@`."NN/"NN."N  H/H.2 N.  㿠 R R @` R`@_@ H ,$@`ٔ`  `@_Ր N -  N G@` H @`  X x@`k%     @` %    @_ % % "8"4`%  @8$  ,`7%    $@@_~  % 4`2 @_U @$%  "%   % % @_B@_a @__ 㿠  @`P @_R@_P @_N㿠  `@_C``2`@_=㿠`2` @_,     ` `(,(@^ג@_㿠 $ $ ``2`$`㿠~ $ $   "  `2 㿠 @^"    2   㿠 `@^`@^ 2`㿠 b9xR㿠@^ 㿠̐@ 㿠@^x@^v 㿠̲  㿠N 1F!Ǥ- -.!Ǥ`@^c*@_Z2`(  $ $ M@M`, &I M@"",  ,@@^ < 8 ( 2M`"M`,M`` ,M`,㿈@]㿠   @_`0( 8 ,@_` @ 4`@8$.$`I  J `@ )  * " &I . ̐w㿠   g@^=< :`   `@^3< :`  4`㿠  -.    0,``"( d@^g< :` 0,`(($0,``(#"z@^< :` 0,`( (($@]g< :` 0,`(($0,``( 1@]ےӇ< :` 0,`( (($z@]̒< :` 0,`( (($@]g< :` 0,`(($0,``(aB6@]< :` 0,`(( (($@]Ӈ< :` 0,`( (($z@]< :` 0,`( (($@]xg< :` 0,`(($0,``r(Є@U>-@]b< :` 0,`((!((($6@]O< :` 0,`(( (($@]>Ӈ< :` 0,`( (($z@]/< :` 0,`( (($@] g< :` 0,`(($0,``(&%f@] < :` 0,`( (!(($>-@\< :` 0,`((!((($6@\< :` 0,`(( (($@\ՒӇ< :` 0,`( (($z@\ƒ< :` 0,`( (($@\g< :` 0,`(($0,``(}xy@\k< :` 0,`( (!((($@\< :` 0,`( (!(($>-@\}< :` 0,`((!((($6@\j< :` 0,`(( (($@\YӇ< :` 0,`( (($z@\J< :` 0,`( (($@\;g< :` 0,`(($0,``5(沄y@\%< :` 0,`( ( ( ( (($@\k< :` 0,`( (!((($@[< :` 0,`( (!(($>-@[< :` 0,`((!((($6@[ْ< :` 0,`(( (($@[ȒӇ< :` 0,`( (($z@[< :` 0,`( (($@[g< :` 0,`(($0,`` (. @[< :` 0,`( (((!((( $y@[< :` 0,`( ( ( ( (($@[mk< :` 0,`( (!((($@[Z< :` 0,`( (!(($>-@[I< :` 0,`((!((($6@[6< :` 0,`(( (($@[%Ӈ< :` 0,`( (($z@[< :` 0,`( (($@[g< :` 0,`(($0,` ` ( .㿠@ @Z|㿘@[ & & 㿘@[v   @Z͒Ӈ<  :`  (!) ( 㿠N # H&2H <" H>" H"2H   2  H2Hː N "N( pN  & # 3 2 ; q u o t a m<  "+("" (&" (*J "(>" (#J (((( J  g<" l((( (((((  (((( ( J 2J (㿘FG @Zhh@ZԔ6 ?@㿘#FbH@Yΐ @Z $bH@Z#`h#dpDd` F …B#\\㿠@k??@@㿠@k? @k<??@@);Ok[WQ  /?"!,i9Ka~֝jבe  7CA f!*7ΑH^P}zdK5 _U^/%=kO[G)6F\I (QۚK5ަ5)n>5#F[uvT~>QwCBBBBQ00000000000000000000000000000000  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~connection_host_name == NULLconnect.cconnection_host_name != NULLconnect.cConnecting to %s[%s]:%hu... Connecting to %s:%hu... connected. Created socket %d. failed: %s. Closing fd %d Master socket fd %d bound. Closing fd %d Closing fd %d Created socket fd %d. Closing fd %d Closing fd %d Deleted old cookie (to be replaced.) Stored cookie %s %d %s %s %d %s %s %s res != 0cookies.cDiscarded old cookie. name_b != NULL && name_e != NULLcookies.cdomainpathexpiresmax-age%lfsecureError in Set-Cookie, field `%s'Syntax error in Set-Cookie at character `%c'. Syntax error in Set-Cookie: premature end of string. cdm: 1 2 3 4 5 6Attempt to fake the domain: %s, %s Attempt to fake the path: %s, %s p != NULLcookies.cocnt == countcookies.cCookie: pos == result_sizecookies.crCannot open cookies file `%s': %s TRUE%lu%s %s %s %s %lu %s %s Saving cookies to %s. wCannot open cookies file `%s': %s # HTTP cookie file. # Generated by Wget on %s. # Edit at your own risk. Error writing to `%s': %s Error closing `%s': %s Done saving cookies. bytecon != NULLftp.ccon->target != NULLftp.c!((cmd & DO_LIST) && (cmd & DO_RETR))ftp.c(cmd & (DO_LIST | DO_CWD | DO_RETR | DO_LOGIN)) != 0ftp.cuser && passwdftp.cLogging in as %s ... Error in server response, closing control connection. Closing fd %d Error in server greeting. Closing fd %d Write failed, closing control connection. Closing fd %d The server refuses login. Closing fd %d Login incorrect. Closing fd %d Logged in! ==> SYST ... Error in server response, closing control connection. Closing fd %d Server error, can't determine system type. done. ==> PWD ... Error in server response, closing control connection. Closing fd %d /Initial VMS directory not in the form [...]! Preprocessing the initial VMS directory old = '%s' new = '%s' done. ==> TYPE %c ... Error in server response, closing control connection. Closing fd %d Write failed, closing control connection. Closing fd %d Unknown type `%c', closing control connection. Closing fd %d done. ==> CWD not needed. changing working directory %s%s%sPrepended initial PWD to relative path: old: '%s' new: '%s' *ntarget == '/'ftp.cChanged file name to VMS syntax: Unix: '%s' VMS: '%s' ==> CWD %s ... Error in server response, closing control connection. Closing fd %d Write failed, closing control connection. Closing fd %d No such directory `%s'. Closing fd %d done. ==> CWD not required. ==> SIZE %s ... Error in server response, closing control connection. Closing fd %d done. ==> PASV ... Error in server response, closing control connection. Closing fd %d Write failed, closing control connection. Closing fd %d Cannot initiate PASV transfer. Cannot parse PASV response. Closing fd %d couldn't connect to %s:%hu: %s done. ==> PORT ... Error in server response, closing control connection. Closing fd %d Write failed, closing control connection. Closing fd %d socket: %s Closing fd %d Bind error (%s). Invalid PORT. Closing fd %d done. ==> REST %ld ... Error in server response, closing control connection. Closing fd %d Write failed, closing control connection. Closing fd %d REST failed; will not truncate `%s'. Closing fd %d REST failed, starting from scratch. done. ==> RETR %s ... Error in server response, closing control connection. Closing fd %d Write failed, closing control connection. Closing fd %d No such file `%s'. done. ==> LIST ... Error in server response, closing control connection. Closing fd %d Write failed, closing control connection. Closing fd %d No such file or directory `%s'. done. Lying FTP server found, adjusting. accept: %s %s: %s Closing fd %d Length: %s [%s to go] Length: %s [%s to go] (unauthoritative) %s: %s, closing control connection. Closing fd %d %s (%s) - Data connection: %s; %s (%s) - Control connection closed. Closing fd %d %s (%s) - Data transfer aborted. Closing fd %d r%s: %s %s File `%s' already there, not retrieving. (try:%2d)--%s-- %s %s => `%s' Closing fd %d %s (%s) - `%s' saved [%ld] %s URL: %s [%ld] -> "%s" [%d] Removing file due to --delete-after in ftp_loop_internal(): Removing %s. unlink: %s Closing fd %d .listingUsing `%s' as listing tmp file. unlink: %s Removed `%s'. Recursion depth %d exceeded max. depth %d. f != NULLftp.cRemote file no newer than local file `%s' -- not retrieving. Remote file is newer than local file `%s' -- retrieving. The sizes do not match (local %ld) -- retrieving. Invalid name of the symlink, skipping. Already have correct symlink %s -> %s Creating symlink %s -> %s symlink: %s Skipping directory `%s'. %s: unknown/unsupported file type. %s: corrupt time-stamp. Unrecognized permissions for %s. Will not retrieve dirs since depth is %d (max %d). %s%s%s/%sComposing new CWD relative to the initial directory. odir = '%s' f->name = '%s' newdir = '%s' Not descending to `%s' as it is excluded/not-included. Rejecting `%s'. %s: %s No matches on pattern `%s'. Wrote HTML-ized index to `%s' [%ld]. Wrote HTML-ized index to `%s'. Closing fd %d %s %s %s%s%s PASS--> %s --> PASS Turtle Power! --> %s USER331 s/key 331 opiekey PASS%d,%d,%d,%d,%d,%dPORTPASVTYPECWDRESTRETRLISTSYST VMSUNIXWINDOWS_NTMACOSPWD""SIZEtype=JanFebMarAprMayJunJulAugSepOctNovDecrb%s: %s total PLAINFILE; DIRECTORY; SYMLINK; UNKNOWN; implicit perms %0o; perms %0o; month: %s; day: %d; year: %d (no tm); time: %02d:%02d:%02d (no yr); -> link to: %s ... Ignoring `.' and `..'; trailing `/' on dir. trailing `@' on link. trailing `*' on exec. Skipping. rb%s: %s Name: '%s' -- :MYYYY/MM/DD HH:MM - %d/%02d/%02d %02d:%02d Timestamp: %ld Directory File, size %ld bytes wrong VMS permissons! JANFEBMARAPRMAYJUNJULAUGSEPOCTNOVDECrb%s: %s file name: '%s' .DIRName: '%s' Directory File Getting additional line empty line read, leaving listing parser confusing VMS listing item, leaving listing parser second token: '%s' -day: '%s' -nonsense in VMS listing, skipping this line date parsed YYYY/MM/DD HH:MM:SS - %d/%02d/%02d %02d:%02d:%02d Timestamp: %ld ,)confusing VMS permissions, skipping line permissions: %s -> 0%o rb%s: %s Unsupported listing type, trying Unix listing parser. wb%s: %s %s%s%s@ ���Index of /%s on %s:%d���

Index of /%s on %s:%d

  %d %s %02d %02d:%02d         time unknown       File        Directory   Link        Not sure    %s  (%s bytes)-> %s
store is `%s' POSIXLY_CORRECT--%s: option `%s' is ambiguous %s: option `--%s' doesn't allow an argument %s: option `%c%s' doesn't allow an argument %s: option `%s' requires an argument %s: unrecognized option `--%s' %s: unrecognized option `%c%s' %s: illegal option -- %c %s: option requires an argument -- %c %s index >= al->faulty && index < al->counthost.cindex == al->faultyhost.ccount > 0host.cReleasing %p (new refcount %d). Deleting unused %p. Caching %s => %s Found %s in host_name_addresses_map (%p) Resolving %s... failed: %s. done. u->host != NULLhost.cHost not foundUnknown erroral->refcount == 1host.cltgtampquotnbspch == '\'' || ch == 0x22html-parse.cch == quote_charhtml-parse.cch == '-'html-parse.cch == '-'html-parse.caappletareabasebgsoundbodyembedfigframeiframeimginputlayerlinkmetaoverlayscripttabletdthhrefcodehrefsrcbackgroundhrefsrcsrcsrcsrchreflowsrcsrcsrcsrcsrcsrcbackgroundbackgroundbackgroundrelhttp-equivnamecontent%s: no base, merge will use "%s". %s: Cannot resolve incomplete link %s. %s: link "%s" doesn't parse. %s: merge("%s", "%s") -> %s %s: merged link "%s" doesn't parse. appending "%s" to urlpos. first != -1html-url.chrefhrefrelstylesheetshortcut iconnamehttp-equivrefreshcontentrobotscontentnonenofollowtagid != -1html-url.c%s: %s Loaded %s (size %ld). no-follow in %s: %d HTTP/bytesnoneKeep-AliveInvalidating fd %d from further reuse. Closing fd %d pc_last_host_ip == NULLhttp.cpc_last_host_ip != NULLhttp.cRegistered fd %d for persistent reuse. Closing fd %d *hs->local_file != NULLhttp.cReusing connection to %s:%hu. Reusing fd %d. Referer: %s Range: bytes=%ld- Wget/%sAuthorizationProxy-Authorization:%d*/*%s %s HTTP/1.0 User-Agent: %s Host: %s%s Accept: %s %s%s%s%s%s%s%s%s ---request begin--- %s---request end--- Failed writing HTTP request: %s. Closing fd %d %s request sent, awaiting response... End of file while parsing headers. Closing fd %d Read error (%s) in headers. Closing fd %d No data receivedMalformed status line(no description) %2d %s%2d %s %2d %sContent-LengthContent-TypeLocationLast-ModifiedSet-CookieWWW-AuthenticateAccept-RangesContent-RangeKeep-AliveConnection inhibit_keep_alive == 0http.cClosing fd %d Authorization failed. Unknown authentication scheme. BasicLocation: %s%s unspecified [following]Closing fd %d text/htmltext/html.htm.html.html The file is already fully retrieved; nothing to do. Closing fd %d Continued download failed on this file, which conflicts with `-c'. Refusing to truncate existing file `%s'. Closing fd %d Closing fd %d Length: (%s to go)ignoredunspecified [%s] Closing fd %d %s: %s Closing fd %d Closing fd %d Closing fd %d Warning: wildcards not supported in HTTP. File `%s' already there, will not retrieve. htmlhtm.orig (try:%2d)--%s-- %s %s => `%s' Cannot write to `%s' (%s). Unable to establish SSL connection. ERROR: Redirection (%d) without location. %s: %s ERROR %d: %s. Last-modified header missing -- time-stamps turned off. Last-modified header invalid -- time-stamp ignored. Server file no newer than local file `%s' -- not retrieving. The sizes do not match (local %ld) -- retrieving. Remote file is newer, retrieving. %d %s %s (%s) - `%s' saved [%ld/%ld] %s URL:%s [%ld/%ld] -> "%s" [%d] %s (%s) - `%s' saved [%ld] %s URL:%s [%ld] -> "%s" [%d] %s (%s) - Connection closed at byte %ld. %s (%s) - `%s' saved [%ld/%ld]) %s URL:%s [%ld/%ld] -> "%s" [%d] %s (%s) - Connection closed at byte %ld/%ld. %s (%s) - Read error at byte %ld (%s).%s (%s) - Read error at byte %ld/%ld (%s). %a, %d %b %Y %T%A, %d-%b-%y %T%a, %d-%b-%Y %T%a %b %d %T %Y%s:%s%s: Basic %s realmopaquenonce:::::Authorization: Digest username="%s", realm="%s", nonce="%s", uri="%s", response="%s", opaque="" BasicDigestNTLMBasicAuthorizationNTLMAuthorizationDigest.anonymous-wget@no_proxyHOMEWGETRC%s: %s: %s. .wgetrc%s/.wgetrcrb%s: Cannot read %s (%s). %s: Error in %s at line %d. %s: Error in %s at line %d. /opt/csw/etc/wgetrc/opt/csw/etc/wgetrc/opt/csw/etc/wgetrc%s: Warning: Both system and user wgetrc point to `%s'. %s: BUG: unknown command `%s', value `%s'. %s: %s: Cannot convert `%s' to an IP address. onoff%s: %s: Please specify on or off. alwaysonoffnever%s: %s: Please specify always, on, off, or never. %s: %s: Invalid specification `%s'. inf%s: Invalid specification `%s' %s: Invalid specification `%s' %s: Invalid specification `%s' %s: Invalid specification `%s' %s: %s: Invalid specification `%s'. %s: %s: Invalid progress type `%s'. %s: %s: Invalid specification `%s'. wget-log %s received, redirecting output to `%s'. w%s: %s; disabling logging. wget/opt/csw/share/localewgetUsage: %s [OPTION]... [URL]... GNU Wget %s, a non-interactive network retriever. Mandatory arguments to long options are mandatory for short options too. Startup: -V, --version display the version of Wget and exit. -h, --help print this help. -b, --background go to background after startup. -e, --execute=COMMAND execute a `.wgetrc'-style command. Logging and input file: -o, --output-file=FILE log messages to FILE. -a, --append-output=FILE append messages to FILE. -d, --debug print debug output. -q, --quiet quiet (no output). -v, --verbose be verbose (this is the default). -nv, --non-verbose turn off verboseness, without being quiet. -i, --input-file=FILE download URLs found in FILE. -F, --force-html treat input file as HTML. -B, --base=URL prepends URL to relative links in -F -i file. --sslcertfile=FILE optional client certificate. --sslcertkey=KEYFILE optional keyfile for this certificate. --egd-file=FILE file name of the EGD socket. Download: --bind-address=ADDRESS bind to ADDRESS (hostname or IP) on local host. -t, --tries=NUMBER set number of retries to NUMBER (0 unlimits). -O --output-document=FILE write documents to FILE. -nc, --no-clobber don't clobber existing files or use .# suffixes. -c, --continue resume getting a partially-downloaded file. --progress=TYPE select progress gauge type. -N, --timestamping don't re-retrieve files unless newer than local. -S, --server-response print server response. --spider don't download anything. -T, --timeout=SECONDS set the read timeout to SECONDS. -w, --wait=SECONDS wait SECONDS between retrievals. --waitretry=SECONDS wait 1...SECONDS between retries of a retrieval. --random-wait wait from 0...2*WAIT secs between retrievals. -Y, --proxy=on/off turn proxy on or off. -Q, --quota=NUMBER set retrieval quota to NUMBER. --limit-rate=RATE limit download rate to RATE. Directories: -nd --no-directories don't create directories. -x, --force-directories force creation of directories. -nH, --no-host-directories don't create host directories. -P, --directory-prefix=PREFIX save files to PREFIX/... --cut-dirs=NUMBER ignore NUMBER remote directory components. HTTP options: --http-user=USER set http user to USER. --http-passwd=PASS set http password to PASS. -C, --cache=on/off (dis)allow server-cached data (normally allowed). -E, --html-extension save all text/html documents with .html extension. --ignore-length ignore `Content-Length' header field. --header=STRING insert STRING among the headers. --proxy-user=USER set USER as proxy username. --proxy-passwd=PASS set PASS as proxy password. --referer=URL include `Referer: URL' header in HTTP request. -s, --save-headers save the HTTP headers to file. -U, --user-agent=AGENT identify as AGENT instead of Wget/VERSION. --no-http-keep-alive disable HTTP keep-alive (persistent connections). --cookies=off don't use cookies. --load-cookies=FILE load cookies from FILE before session. --save-cookies=FILE save cookies to FILE after session. FTP options: -nr, --dont-remove-listing don't remove `.listing' files. -g, --glob=on/off turn file name globbing on or off. --passive-ftp use the "passive" transfer mode. --retr-symlinks when recursing, get linked-to files (not dirs). Recursive retrieval: -r, --recursive recursive web-suck -- use with care! -l, --level=NUMBER maximum recursion depth (inf or 0 for infinite). --delete-after delete files locally after downloading them. -k, --convert-links convert non-relative links to relative. -K, --backup-converted before converting file X, back up as X.orig. -m, --mirror shortcut option equivalent to -r -N -l inf -nr. -p, --page-requisites get all images, etc. needed to display HTML page. Recursive accept/reject: -A, --accept=LIST comma-separated list of accepted extensions. -R, --reject=LIST comma-separated list of rejected extensions. -D, --domains=LIST comma-separated list of accepted domains. --exclude-domains=LIST comma-separated list of rejected domains. --follow-ftp follow FTP links from HTML documents. --follow-tags=LIST comma-separated list of followed HTML tags. -G, --ignore-tags=LIST comma-separated list of ignored HTML tags. -H, --span-hosts go to foreign hosts when recursive. -L, --relative follow relative links only. -I, --include-directories=LIST list of allowed directories. -X, --exclude-directories=LIST list of excluded directories. -np, --no-parent don't ascend to the parent directory. Mail bug reports and suggestions to . spideronnoparentondeleteafteronretrsymlinksonignorelengthonpassiveftponnoclobberonfollowftponcutdirsverboseoffdirstructoffaddhostdiroffremovelistingoffbindaddresshttpkeepaliveoffrandomwaitonbackgroundoncontinueondebugonhtmlextensiononforcehtmlonspanhostsonbackupconvertedonconvertlinksonrelativeonlyonmirrorontimestampingonpagerequisitesonserverresponseonsaveheadersonquietonrecursiveonGNU Wget %s %sCopyright (C) 1995, 1996, 1997, 1998, 2000, 2001 Free Software Foundation, Inc. %sThis program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. Originally written by Hrvoje Niksic . verboseondirstructonhttpuserhttppasswdheaderdotstylehtmlifyexcludedomainsproxyuserproxypasswdbackupswaitretryfollowtagscookiesloadcookiessavecookiesprogresslimitraterefereracceptlogfilebasecachedomains%s: %s: invalid command ignoretagsglobincludedirectoriesinputreclevelverboseoffaddhostdiroffdirstructoffnoclobberonremovelistingoffnoparentonhttpkeepaliveoff%s: illegal option -- `-n%c' Try `%s --help' for more options. outputdocumentlogfiledirprefixquotarejecttimeouttriesuseragentwaitexcludedirectoriesuseproxy Try `%s --help' for more options. Can't be verbose and quiet at the same time. Can't timestamp and not clobber old files at the same time. %s: missing URL Try `%s --help' for more options. DEBUG output created by Wget %s on %s. Removing file due to --delete-after in main(): Removing %s. unlink: %s No URLs found in %s. FINISHED --%s-- Downloaded: %s bytes in %d files Download quota (%s bytes) EXCEEDED! .netrc%s/%sr%s: Cannot read %s (%s). %s: %s:%d: warning: "%s" token appears before any machine name accountdefaultloginmacdefmachinepassword%s: %s:%d: unknown token "%s" bardot %*s[ skipping %dK ] %5ldK ,dp->dots < opt.dots_in_lineprogress.c%3d%% %s %5ldK . %5ldK defaultbinarymegagigaInvalid dot style specification `%s'; leaving unchanged. percentage <= 100progress.c%2d%% 100% dlsz <= progress_sizeprogress.c %-11s %7.2f%s --.--K/s ETA --:--%d:%02d:%02d%02d:%02d ETA --:--p - bp->buffer <= bp->widthprogress.c TERMforceemacsdotEnqueuing %s at depth %d Queue count %d, maxcount %d. Dequeuing %s at depth %d Queue count %d, maxcount %d. %s: %s. Already downloaded "%s", reusing it from "%s". Not descending further; at depth %d, max. %d. url_parsed != NULLrecur.cRemoving file due to %s in recursive_retrieve(): Removing %s. Removing %s since it should be rejected. unlink: %s Deciding whether to enqueue "%s". Already on the black list. Not following non-HTTP schemes. It doesn't really look like a relative link. The domain was not accepted. Going to "%s" would escape "%s" with no_parent on. %s (%s) is excluded/not-included. htmlhtm%s (%s) does not match acc/rej rules. This is not the same hostname as the parent's (%s and %s). Not following %s because robots.txt forbids it. Decided to load it. Decided NOT to load it. orig_parsed != NULLrecur.cnew_parsed != NULLrecur.cRedirection "%s" failed the test. /index.htmlfile != NULLrecur.cApparently %s has been removed. Scanning %s (from %s) will convert url %s to local %s will convert url %s to complete Converted %d files in %.2f seconds. wgetj == cntres.c!EOL (p)res.cIgnoring malformed line %duser-agentallowdisallowIgnoring unknown field at line %dCannot open %s: %s%s path %s because of rule `%s'. /robots.txtLoading robots.txt; please ignore errors. deferring a %ld ms sleep (%ld/%ld) until later. sleeping %ld ms msecs >= 0retr.cbytes >= 0retr.c%s: %s. Could not find proxy host. Error parsing proxy URL %s: %s. Error in proxy URL %s: Must be HTTP. htmlhtmmynewloc != NULLretr.c%s: %s. %d redirections exceeded. %s: Redirection cycle detected. Removing file due to --delete-after in retrieve_from_file(): Removing %s. unlink: %s Giving up. Retrying. sleep_between_retrievals: norm=%ld,fuzz=%ld,sleep=%d p2 - newstr == newlenurl.cp2 - newstr == newlenurl.c/?@ftp://%shttp://%s:/;?#/;?#;?#?##*p == 0url.cerror_code >= 0 && error_code < ARRAY_SIZE (parse_errors)url.c%s: %s Loaded %s (size %ld). %s: Invalid URL %s: %s %s.%d%s.%d%s.%dRemoving %s because of directory danger! %s: %s%s/%s%s%s%s%s%s%s?%s/%s?;#scheme_str != NULLurl.cp - result == sizeurl.chttp_proxyftp_proxyConverting %s... nothing to do. Cannot convert links in %s: %s Unable to delete `%s': %s wbCannot convert links in %s: %s Something strange is going on. Please investigate.Skipping %s at position %d. TO_RELATIVE: %s to %s at position %d in %s. TO_COMPLETE: to %s at position %d in %s. %d-%d *s1 != '/'url.c../orig.origCannot back up %s as %s: %s %d; URL=%sto - newname == fsqlenurl.c%s: %s: Not enough memory. mallocreallocstrdup%02d:%02d:%02d%04d-%02d-%02d %02d:%02d:%02dwget-logforkContinuing in background, pid %d. Output will be written to `%s'. /dev/nullr/dev/nullw/dev/nullwutime(%s): %s Unlinking %s (symlink). Failed to unlink symlink `%s': %s %s.%d00<0H0T0`0l0x00000000000000 0,080D0P0\0h0t0000000000000~0{0x(0u40r@0oL0lX0id0fp0c|0`0]0Z0W0T0Q0N0K0H0E0B0? 0<09$06003<00H0-T0*`0'l0$x0!0000000 0 00000 0,080D0P0\0h0t000000000000000(040@0L0X0d0p0 C DH#  \ oo4oL55 ooH@ܐܘܠܨܸܰahatb b$b(b,b0b4b8b<b@bDbHbLdPdTdXd\d`dddhdldpdtdxd| $(,048<@AABEACEACTADADAADDAGOAIDAIMAIRALLALPAMAMYANANAANDANNANTANYAPEAPSAPTARCAREARKARMARTASASHASKATATEAUGAUKAVEAWEAWKAWLAWNAXAYEBADBAGBAHBAMBANBARBATBAYBEBEDBEEBEGBENBETBEYBIBBIDBIGBINBITBOBBOGBONBOOBOPBOWBOYBUBBUDBUGBUMBUNBUSBUTBUYBYBYECABCALCAMCANCAPCARCATCAWCODCOGCOLCONCOOCOPCOTCOWCOYCRYCUBCUECUPCURCUTDABDADDAMDANDARDAYDEEDELDENDESDEWDIDDIEDIGDINDIPDODOEDOGDONDOTDOWDRYDUBDUDDUEDUGDUNEAREATEDEELEGGEGOELIELKELMELYEMENDESTETCEVAEVEEWEEYEFADFANFARFATFAYFEDFEEFEWFIBFIGFINFIRFITFLOFLYFOEFOGFORFRYFUMFUNFURGABGADGAGGALGAMGAPGASGAYGEEGELGEMGETGIGGILGINGOGOTGUMGUNGUSGUTGUYGYMGYPHAHADHALHAMHANHAPHASHATHAWHAYHEHEMHENHERHEWHEYHIHIDHIMHIPHISHITHOHOBHOCHOEHOGHOPHOTHOWHUBHUEHUGHUHHUMHUTIICYIDAIFIKEILLINKINNIOIONIQIRAIREIRKISITITSIVYJABJAGJAMJANJARJAWJAYJETJIGJIMJOJOBJOEJOGJOTJOYJUGJUTKAYKEGKENKEYKIDKIMKINKITLALABLACLADLAGLAMLAPLAWLAYLEALEDLEELEGLENLEOLETLEWLIDLIELINLIPLITLOLOBLOGLOPLOSLOTLOULOWLOYLUGLYEMAMACMADMAEMANMAOMAPMATMAWMAYMEMEGMELMENMETMEWMIDMINMITMOBMODMOEMOOMOPMOSMOTMOWMUDMUGMUMMYNABNAGNANNAPNATNAYNENEDNEENETNEWNIBNILNIPNITNONOBNODNONNORNOTNOVNOWNUNUNNUTOOAFOAKOAROATODDODEOFOFFOFTOHOILOKOLDONONEORORBOREORROSOTTOUROUTOVAOWOWEOWLOWNOXPAPADPALPAMPANPAPPARPATPAWPAYPEAPEGPENPEPPERPETPEWPHIPIPIEPINPITPLYPOPODPOEPOPPOTPOWPROPRYPUBPUGPUNPUPPUTQUORAGRAMRANRAPRATRAWRAYREBREDREPRETRIBRIDRIGRIMRIORIPROBRODROERONROTROWROYRUBRUERUGRUMRUNRYESACSADSAGSALSAMSANSAPSATSAWSAYSEASECSEESENSETSEWSHESHYSINSIPSIRSISSITSKISKYSLYSOSOBSODSONSOPSOWSOYSPASPYSUBSUDSUESUMSUNSUPTABTADTAGTANTAPTARTEATEDTEETENTHETHYTICTIETIMTINTIPTOTOETOGTOMTONTOOTOPTOWTOYTRYTUBTUGTUMTUNTWOUNUPUSUSEVANVATVETVIEWADWAGWARWASWAYWEWEBWEDWEEWETWHOWHYWINWITWOKWONWOOWOWWRYWUYAMYAPYAWYEYEAYESYETYOUABEDABELABETABLEABUTACHEACIDACMEACREACTAACTSADAMADDSADENAFARAFROAGEEAHEMAHOYAIDAAIDEAIDSAIRYAJARAKINALANALECALGAALIAALLYALMAALOEALSOALTOALUMALVAAMENAMESAMIDAMMOAMOKAMOSAMRAANDYANEWANNAANNEANTEANTIAQUAARABARCHAREAARGOARIDARMYARTSARTYASIAASKSATOMAUNTAURAAUTOAVERAVIDAVISAVONAVOWAWAYAWRYBABEBABYBACHBACKBADEBAILBAITBAKEBALDBALEBALIBALKBALLBALMBANDBANEBANGBANKBARBBARDBAREBARKBARNBARRBASEBASHBASKBASSBATEBATHBAWDBAWLBEADBEAKBEAMBEANBEARBEATBEAUBECKBEEFBEENBEERBEETBELABELLBELTBENDBENTBERGBERNBERTBESSBESTBETABETHBHOYBIASBIDEBIENBILEBILKBILLBINDBINGBIRDBITEBITSBLABBLATBLEDBLEWBLOBBLOCBLOTBLOWBLUEBLUMBLURBOARBOATBOCABOCKBODEBODYBOGYBOHRBOILBOLDBOLOBOLTBOMBBONABONDBONEBONGBONNBONYBOOKBOOMBOONBOOTBOREBORGBORNBOSEBOSSBOTHBOUTBOWLBOYDBRADBRAEBRAGBRANBRAYBREDBREWBRIGBRIMBROWBUCKBUDDBUFFBULBBULKBULLBUNKBUNTBUOYBURGBURLBURNBURRBURTBURYBUSHBUSSBUSTBUSYBYTECADYCAFECAGECAINCAKECALFCALLCALMCAMECANECANTCARDCARECARLCARRCARTCASECASHCASKCASTCAVECEILCELLCENTCERNCHADCHARCHATCHAWCHEFCHENCHEWCHICCHINCHOUCHOWCHUBCHUGCHUMCITECITYCLADCLAMCLANCLAWCLAYCLODCLOGCLOTCLUBCLUECOALCOATCOCACOCKCOCOCODACODECODYCOEDCOILCOINCOKECOLACOLDCOLTCOMACOMBCOMECOOKCOOLCOONCOOTCORDCORECORKCORNCOSTCOVECOWLCRABCRAGCRAMCRAYCREWCRIBCROWCRUDCUBACUBECUFFCULLCULTCUNYCURBCURDCURECURLCURTCUTSDADEDALEDAMEDANADANEDANGDANKDAREDARKDARNDARTDASHDATADATEDAVEDAVYDAWNDAYSDEADDEAFDEALDEANDEARDEBTDECKDEEDDEEMDEERDEFTDEFYDELLDENTDENYDESKDIALDICEDIEDDIETDIMEDINEDINGDINTDIREDIRTDISCDISHDISKDIVEDOCKDOESDOLEDOLLDOLTDOMEDONEDOOMDOORDORADOSEDOTEDOUGDOURDOVEDOWNDRABDRAGDRAMDRAWDREWDRUBDRUGDRUMDUALDUCKDUCTDUELDUETDUKEDULLDUMBDUNEDUNKDUSKDUSTDUTYEACHEARLEARNEASEEASTEASYEBENECHOEDDYEDENEDGEEDGYEDITEDNAEGANELANELBAELLAELSEEMILEMITEMMAENDSERICEROSEVENEVEREVILEYEDFACEFACTFADEFAILFAINFAIRFAKEFALLFAMEFANGFARMFASTFATEFAWNFEARFEATFEEDFEELFEETFELLFELTFENDFERNFESTFEUDFIEFFIGSFILEFILLFILMFINDFINEFINKFIREFIRMFISHFISKFISTFITSFIVEFLAGFLAKFLAMFLATFLAWFLEAFLEDFLEWFLITFLOCFLOGFLOWFLUBFLUEFOALFOAMFOGYFOILFOLDFOLKFONDFONTFOODFOOLFOOTFORDFOREFORKFORMFORTFOSSFOULFOURFOWLFRAUFRAYFREDFREEFRETFREYFROGFROMFUELFULLFUMEFUNDFUNKFURYFUSEFUSSGAFFGAGEGAILGAINGAITGALAGALEGALLGALTGAMEGANGGARBGARYGASHGATEGAULGAURGAVEGAWKGEARGELDGENEGENTGERMGETSGIBEGIFTGILDGILLGILTGINAGIRDGIRLGISTGIVEGLADGLEEGLENGLIBGLOBGLOMGLOWGLUEGLUMGLUTGOADGOALGOATGOERGOESGOLDGOLFGONEGONGGOODGOOFGOREGORYGOSHGOUTGOWNGRABGRADGRAYGREGGREWGREYGRIDGRIMGRINGRITGROWGRUBGULFGULLGUNKGURUGUSHGUSTGWENGWYNHAAGHAASHACKHAILHAIRHALEHALFHALLHALOHALTHANDHANGHANKHANSHARDHARKHARMHARTHASHHASTHATEHATHHAULHAVEHAWKHAYSHEADHEALHEARHEATHEBEHECKHEEDHEELHEFTHELDHELLHELMHERBHERDHEREHEROHERSHESSHEWNHICKHIDEHIGHHIKEHILLHILTHINDHINTHIREHISSHIVEHOBOHOCKHOFFHOLDHOLEHOLMHOLTHOMEHONEHONKHOODHOOFHOOKHOOTHORNHOSEHOSTHOURHOVEHOWEHOWLHOYTHUCKHUEDHUFFHUGEHUGHHUGOHULKHULLHUNKHUNTHURDHURLHURTHUSHHYDEHYMNIBISICONIDEAIDLEIFFYINCAINCHINTOIONSIOTAIOWAIRISIRMAIRONISLEITCHITEMIVANJACKJADEJAILJAKEJANEJAVAJEANJEFFJERKJESSJESTJIBEJILLJILTJIVEJOANJOBSJOCKJOELJOEYJOHNJOINJOKEJOLTJOVEJUDDJUDEJUDOJUDYJUJUJUKEJULYJUNEJUNKJUNOJURYJUSTJUTEKAHNKALEKANEKANTKARLKATEKEELKEENKENOKENTKERNKERRKEYSKICKKILLKINDKINGKIRKKISSKITEKLANKNEEKNEWKNITKNOBKNOTKNOWKOCHKONGKUDOKURDKURTKYLELACELACKLACYLADYLAIDLAINLAIRLAKELAMBLAMELANDLANELANGLARDLARKLASSLASTLATELAUDLAVALAWNLAWSLAYSLEADLEAFLEAKLEANLEARLEEKLEERLEFTLENDLENSLENTLEONLESKLESSLESTLETSLIARLICELICKLIEDLIENLIESLIEULIFELIFTLIKELILALILTLILYLIMALIMBLIMELINDLINELINKLINTLIONLISALISTLIVELOADLOAFLOAMLOANLOCKLOFTLOGELOISLOLALONELONGLOOKLOONLOOTLORDLORELOSELOSSLOSTLOUDLOVELOWELUCKLUCYLUGELUKELULULUNDLUNGLURALURELURKLUSHLUSTLYLELYNNLYONLYRAMACEMADEMAGIMAIDMAILMAINMAKEMALEMALIMALLMALTMANAMANNMANYMARCMAREMARKMARSMARTMARYMASHMASKMASSMASTMATEMATHMAULMAYOMEADMEALMEANMEATMEEKMEETMELDMELTMEMOMENDMENUMERTMESHMESSMICEMIKEMILDMILEMILKMILLMILTMIMIMINDMINEMINIMINKMINTMIREMISSMISTMITEMITTMOANMOATMOCKMODEMOLDMOLEMOLLMOLTMONAMONKMONTMOODMOONMOORMOOTMOREMORNMORTMOSSMOSTMOTHMOVEMUCHMUCKMUDDMUFFMULEMULLMURKMUSHMUSTMUTEMUTTMYRAMYTHNAGYNAILNAIRNAMENARYNASHNAVENAVYNEALNEARNEATNECKNEEDNEILNELLNEONNERONESSNESTNEWSNEWTNIBSNICENICKNILENINANINENOAHNODENOELNOLLNONENOOKNOONNORMNOSENOTENOUNNOVANUDENULLNUMBOATHOBEYOBOEODINOHIOOILYOINTOKAYOLAFOLDYOLGAOLINOMANOMENOMITONCEONESONLYONTOONUSORALORGYOSLOOTISOTTOOUCHOUSTOUTSOVALOVENOVEROWLYOWNSQUADQUITQUODRACERACKRACYRAFTRAGERAIDRAILRAINRAKERANKRANTRARERASHRATERAVERAYSREADREALREAMREARRECKREEDREEFREEKREELREIDREINRENARENDRENTRESTRICERICHRICKRIDERIFTRILLRIMERINGRINKRISERISKRITEROADROAMROARROBEROCKRODEROILROLLROMEROODROOFROOKROOMROOTROSAROSEROSSROSYROTHROUTROVEROWEROWSRUBERUBYRUDERUDYRUINRULERUNGRUNSRUNTRUSERUSHRUSKRUSSRUSTRUTHSACKSAFESAGESAIDSAILSALESALKSALTSAMESANDSANESANGSANKSARASAULSAVESAYSSCANSCARSCATSCOTSEALSEAMSEARSEATSEEDSEEKSEEMSEENSEESSELFSELLSENDSENTSETSSEWNSHAGSHAMSHAWSHAYSHEDSHIMSHINSHODSHOESHOTSHOWSHUNSHUTSICKSIDESIFTSIGHSIGNSILKSILLSILOSILTSINESINGSINKSIRESITESITSSITUSKATSKEWSKIDSKIMSKINSKITSLABSLAMSLATSLAYSLEDSLEWSLIDSLIMSLITSLOBSLOGSLOTSLOWSLUGSLUMSLURSMOGSMUGSNAGSNOBSNOWSNUBSNUGSOAKSOARSOCKSODASOFASOFTSOILSOLDSOMESONGSOONSOOTSORESORTSOULSOURSOWNSTABSTAGSTANSTARSTAYSTEMSTEWSTIRSTOWSTUBSTUNSUCHSUDSSUITSULKSUMSSUNGSUNKSURESURFSWABSWAGSWAMSWANSWATSWAYSWIMSWUMTACKTACTTAILTAKETALETALKTALLTANKTASKTATETAUTTEALTEAMTEARTECHTEEMTEENTEETTELLTENDTENTTERMTERNTESSTESTTHANTHATTHEETHEMTHENTHEYTHINTHISTHUDTHUGTICKTIDETIDYTIEDTIERTILETILLTILTTIMETINATINETINTTINYTIRETOADTOGOTOILTOLDTOLLTONETONGTONYTOOKTOOLTOOTTORETORNTOTETOURTOUTTOWNTRAGTRAMTRAYTREETREKTRIGTRIMTRIOTRODTROTTROYTRUETUBATUBETUCKTUFTTUNATUNETUNGTURFTURNTUSKTWIGTWINTWITULANUNITURGEUSEDUSERUSESUTAHVAILVAINVALEVARYVASEVASTVEALVEDAVEILVEINVENDVENTVERBVERYVETOVICEVIEWVINEVISEVOIDVOLTVOTEWACKWADEWAGEWAILWAITWAKEWALEWALKWALLWALTWANDWANEWANGWANTWARDWARMWARNWARTWASHWASTWATSWATTWAVEWAVYWAYSWEAKWEALWEANWEARWEEDWEEKWEIRWELDWELLWELTWENTWEREWERTWESTWHAMWHATWHEEWHENWHETWHOAWHOMWICKWIFEWILDWILLWINDWINEWINGWINKWINOWIREWISEWISHWITHWOLFWONTWOODWOOLWORDWOREWORKWORMWORNWOVEWRITWYNNYALEYANGYANKYARDYARNYAWLYAWNYEAHYEARYELLYOGAYOKE?kkkkkkkkkkkkkkk\kll llll$l,l4l8lDlLlPlT lX l\ ld ll lp ltlxl|lllllllx(x8xHxXABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/xxx $lxhdXhdhdhd jk g(hd0Xhd<hdL$hdTj\hddhdpkH|pވ4lxސm|ޜ jިj޴k,l8lxDhd<lxhdkhhdq<$hd4r@<|hdLtkXkdkppk|hdߌ@lxߘ0l߬kHߴhdm|(kHkH\krdhd hdhdlxj$LkH4hdDliP`kXsdkpk|hdm|hdjs|k(lxhdhdHhdhd,kHhdhd hd, hd4o(<hdLjThd`slhdto(|o(bKckdxx$F0h8EHXm`l|pqrL$s4SDHPXNhvpVxAaBCPDeX ,g4<DP\GhI|ilnOoYQR T$t,U8@YLwTL$0PPX\`dP,|permanentnonpermanent.com.edu.net.org.gov.mil.intTRUEFALSETRUEFALSE/.abwb :JanFebMarAprMayJunJulAugSepOctNovDec(nil)HEADGETPragma: no-cache Connection: Keep-Alive */*ProxyHTTPabwbacceptaddhostdiralwaysrestbackgroundbackupconvertedbackupsbasebindaddresscachecontinueconvertlinkscookiescutdirsdebugdeleteafterdirprefixdirstructdomainsdotbytesdotsinlinedotspacingdotstyleexcludedirectoriesexcludedomainsfollowftpfollowtagsforcehtmlftpproxyglobheaderhtmlextensionhtmlifyhttpkeepalivehttppasswdhttpproxyhttpsproxyhttpuserignorelengthignoretagsincludedirectoriesinputkilllongerlimitrateloadcookieslogfileloginmirrornetrcnoclobbernoparentnoproxynumtriesoutputdocumentpagerequisitespassiveftppasswdprogressproxypasswdproxyuserquietquotarandomwaitreclevelrecursiverefererrejectrelativeonlyremovelistingretrsymlinksrobotssavecookiessaveheadersserverresponsespanhostsspidertimeouttimestampingtriesuseproxyuseragentverbosewaitwaitretryawbackgroundbackup-convertedcontinueconvert-linksdebugdelete-afterdont-remove-listingfollow-ftpforce-directoriesforce-hierforce-htmlhelphtml-extensionignore-lengthmirrorno-clobberno-directoriesno-host-directoriesno-host-lookupno-http-keep-aliveno-parentnon-verbosepassive-ftppage-requisitesquietrandom-waitrecursiverelativeretr-symlinkssave-headersserver-responsespan-hostsspidertimestampingverboseversionacceptappend-outputbackupsbasebind-addresscachecookiescut-dirsdirectory-prefixdomainsdot-styleexecuteexclude-directoriesexclude-domainsfollow-tagsglobheaderhtmlifyhttp-passwdhttp-userignore-tagsinclude-directoriesinput-filelevellimit-rateload-cookiesnooutput-documentoutput-fileprogressproxyproxy-passwdproxy-userquotarejectsave-cookiestimeouttriesuser-agentrefereruse-proxywaitwaitretryhpVqvdkKsxmNWrHSLcFbEY:G:g:T:U:O:l:n:i:o:a:t:D:A:R:P:B:e:Q:X:I:w:C:hpVqvdkKsxmNWrHSLcFbEY:G:g:T:U:O:l:n:i:o:a:t:D:A:R:P:B:e:Q:X:I:w:C:solaris2.8abwbSIGHUPSIGUSR1WTF?!.netrcloginpasswordmacdefaccountdotbarB/sK/sM/sG/s--delete-afterrecursive rejection criteriaAllowingRejectingB/sKB/sMB/sGB/s%7.2f %s%.2f %shttp://ftp://No errorUnsupported schemeEmpty hostBad port numberInvalid user name/index.html/index.html*password*11.8.2cg: Sun WorkShop 6 update 1 Compiler Common 6.1 2000/09/11@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.68 02/06/10 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.66 01/01/17 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.25 98/06/30 SMI@(#)siginfo.h 1.54 98/03/27 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/02/14 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)limits.h 1.51 99/10/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)libintl.h 1.12 97/08/20 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMIacomp: Sun WorkShop 6 update 1 C 5.2 2000/09/11cg: Sun WorkShop 6 update 1 Compiler Common 6.1 2000/09/11@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.68 02/06/10 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.66 01/01/17 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)socket.h 1.54 01/03/12 SMI@(#)uio.h 1.29 97/06/29 SMI@(#)netconfig.h 1.20 99/04/27 SMI@(#)in.h 1.31 00/10/28 SMI@(#)stream.h 1.86 00/10/23 SMI@(#)vnode.h 1.85 99/07/30 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.21 00/04/27 SMI@(#)param.h 1.76 00/02/14 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/03/15 SMI@(#)cred.h 1.21 97/01/09 SMI@(#)resource.h 1.25 98/06/30 SMI@(#)seg_enum.h 1.3 95/12/22 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.20 97/09/22 SMI@(#)strft.h 1.2 00/10/23 SMI@(#)byteorder.h 1.14 98/04/19 SMI@(#)un.h 1.9 96/07/12 SMI@(#)if_dl.h 1.7 98/01/06 SMI@(#)netdb.h 1.25 01/05/08 SMI@(#)inet.h 1.18 01/01/16 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)libintl.h 1.12 97/08/20 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMIacomp: Sun WorkShop 6 update 1 C 5.2 2000/09/11cg: Sun WorkShop 6 update 1 Compiler Common 6.1 2000/09/11@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.68 02/06/10 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.66 01/01/17 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.25 98/06/30 SMI@(#)siginfo.h 1.54 98/03/27 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/02/14 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)libintl.h 1.12 97/08/20 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMIacomp: Sun WorkShop 6 update 1 C 5.2 2000/09/11cg: Sun WorkShop 6 update 1 Compiler Common 6.1 2000/09/11@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.68 02/06/10 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.66 01/01/17 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)libintl.h 1.12 97/08/20 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMIacomp: Sun WorkShop 6 update 1 C 5.2 2000/09/11cg: Sun WorkShop 6 update 1 Compiler Common 6.1 2000/09/11@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.68 02/06/10 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.66 01/01/17 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.25 98/06/30 SMI@(#)siginfo.h 1.54 98/03/27 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/02/14 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)libintl.h 1.12 97/08/20 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMIacomp: Sun WorkShop 6 update 1 C 5.2 2000/09/11cg: Sun WorkShop 6 update 1 Compiler Common 6.1 2000/09/11@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.68 02/06/10 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.66 01/01/17 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.25 98/06/30 SMI@(#)siginfo.h 1.54 98/03/27 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/02/14 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)libintl.h 1.12 97/08/20 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMIacomp: Sun WorkShop 6 update 1 C 5.2 2000/09/11cg: Sun WorkShop 6 update 1 Compiler Common 6.1 2000/09/11@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.68 02/06/10 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.66 01/01/17 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.25 98/06/30 SMI@(#)siginfo.h 1.54 98/03/27 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/02/14 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)libintl.h 1.12 97/08/20 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMIacomp: Sun WorkShop 6 update 1 C 5.2 2000/09/11cg: Sun WorkShop 6 update 1 Compiler Common 6.1 2000/09/11@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.68 02/06/10 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.66 01/01/17 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.25 98/06/30 SMI@(#)siginfo.h 1.54 98/03/27 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/02/14 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)libintl.h 1.12 97/08/20 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMIacomp: Sun WorkShop 6 update 1 C 5.2 2000/09/11cg: Sun WorkShop 6 update 1 Compiler Common 6.1 2000/09/11@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.68 02/06/10 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.66 01/01/17 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)libintl.h 1.12 97/08/20 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.25 98/06/30 SMI@(#)siginfo.h 1.54 98/03/27 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/02/14 SMIacomp: Sun WorkShop 6 update 1 C 5.2 2000/09/11cg: Sun WorkShop 6 update 1 Compiler Common 6.1 2000/09/11@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.68 02/06/10 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.66 01/01/17 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.25 98/06/30 SMI@(#)siginfo.h 1.54 98/03/27 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/02/14 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)libintl.h 1.12 97/08/20 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMIacomp: Sun WorkShop 6 update 1 C 5.2 2000/09/11cg: Sun WorkShop 6 update 1 Compiler Common 6.1 2000/09/11@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.68 02/06/10 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.66 01/01/17 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.25 98/06/30 SMI@(#)siginfo.h 1.54 98/03/27 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/02/14 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)libintl.h 1.12 97/08/20 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMIacomp: Sun WorkShop 6 update 1 C 5.2 2000/09/11cg: Sun WorkShop 6 update 1 Compiler Common 6.1 2000/09/11@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.68 02/06/10 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.66 01/01/17 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.25 98/06/30 SMI@(#)siginfo.h 1.54 98/03/27 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/02/14 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)socket.h 1.54 01/03/12 SMI@(#)uio.h 1.29 97/06/29 SMI@(#)netconfig.h 1.20 99/04/27 SMI@(#)in.h 1.31 00/10/28 SMI@(#)stream.h 1.86 00/10/23 SMI@(#)vnode.h 1.85 99/07/30 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.21 00/04/27 SMI@(#)param.h 1.76 00/02/14 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/03/15 SMI@(#)cred.h 1.21 97/01/09 SMI@(#)seg_enum.h 1.3 95/12/22 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.20 97/09/22 SMI@(#)strft.h 1.2 00/10/23 SMI@(#)byteorder.h 1.14 98/04/19 SMI@(#)un.h 1.9 96/07/12 SMI@(#)if_dl.h 1.7 98/01/06 SMI@(#)inet.h 1.18 01/01/16 SMI@(#)netdb.h 1.25 01/05/08 SMI@(#)utsname.h 1.26 98/12/03 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)libintl.h 1.12 97/08/20 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMIacomp: Sun WorkShop 6 update 1 C 5.2 2000/09/11cg: Sun WorkShop 6 update 1 Compiler Common 6.1 2000/09/11@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.68 02/06/10 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.66 01/01/17 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.25 98/06/30 SMI@(#)siginfo.h 1.54 98/03/27 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/02/14 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)libintl.h 1.12 97/08/20 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMIacomp: Sun WorkShop 6 update 1 C 5.2 2000/09/11cg: Sun WorkShop 6 update 1 Compiler Common 6.1 2000/09/11@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.68 02/06/10 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.66 01/01/17 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.25 98/06/30 SMI@(#)siginfo.h 1.54 98/03/27 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/02/14 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)libintl.h 1.12 97/08/20 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMIacomp: Sun WorkShop 6 update 1 C 5.2 2000/09/11cg: Sun WorkShop 6 update 1 Compiler Common 6.1 2000/09/11@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.68 02/06/10 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.66 01/01/17 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.25 98/06/30 SMI@(#)siginfo.h 1.54 98/03/27 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/02/14 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)libintl.h 1.12 97/08/20 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMIacomp: Sun WorkShop 6 update 1 C 5.2 2000/09/11cg: Sun WorkShop 6 update 1 Compiler Common 6.1 2000/09/11@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.68 02/06/10 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.66 01/01/17 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.25 98/06/30 SMI@(#)siginfo.h 1.54 98/03/27 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/02/14 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)socket.h 1.54 01/03/12 SMI@(#)uio.h 1.29 97/06/29 SMI@(#)netconfig.h 1.20 99/04/27 SMI@(#)in.h 1.31 00/10/28 SMI@(#)stream.h 1.86 00/10/23 SMI@(#)vnode.h 1.85 99/07/30 SMI@(#)t_lock.h 1.45 98/02/01 SMI@(#)machlock.h 1.21 00/04/27 SMI@(#)param.h 1.76 00/02/14 SMI@(#)mutex.h 1.20 98/02/01 SMI@(#)rwlock.h 1.9 98/02/18 SMI@(#)semaphore.h 1.5 98/02/01 SMI@(#)condvar.h 1.13 01/03/15 SMI@(#)cred.h 1.21 97/01/09 SMI@(#)seg_enum.h 1.3 95/12/22 SMI@(#)poll.h 1.28 98/11/23 SMI@(#)strmdep.h 1.10 98/01/06 SMI@(#)model.h 1.20 97/09/22 SMI@(#)strft.h 1.2 00/10/23 SMI@(#)byteorder.h 1.14 98/04/19 SMI@(#)un.h 1.9 96/07/12 SMI@(#)if_dl.h 1.7 98/01/06 SMI@(#)inet.h 1.18 01/01/16 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)libintl.h 1.12 97/08/20 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMIacomp: Sun WorkShop 6 update 1 C 5.2 2000/09/11cg: Sun WorkShop 6 update 1 Compiler Common 6.1 2000/09/11@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.68 02/06/10 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.66 01/01/17 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.25 98/06/30 SMI@(#)siginfo.h 1.54 98/03/27 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/02/14 SMI@(#)stdarg.h 1.45 99/08/10 SMI@(#)stdarg_iso.h 1.1 99/08/09 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)libintl.h 1.12 97/08/20 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMIacomp: Sun WorkShop 6 update 1 C 5.2 2000/09/11cg: Sun WorkShop 6 update 1 Compiler Common 6.1 2000/09/11@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.68 02/06/10 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.66 01/01/17 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.25 98/06/30 SMI@(#)siginfo.h 1.54 98/03/27 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/02/14 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)signal.h 1.38 99/08/10 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal.h 1.54 99/07/26 SMI@(#)locale.h 1.19 99/08/10 SMI@(#)locale_iso.h 1.1 99/08/09 SMI@(#)libintl.h 1.12 97/08/20 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMIacomp: Sun WorkShop 6 update 1 C 5.2 2000/09/11cg: Sun WorkShop 6 update 1 Compiler Common 6.1 2000/09/11@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.68 02/06/10 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.66 01/01/17 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)libintl.h 1.12 97/08/20 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)md5.h 1.1 99/07/02 SMI@(#)md5.h 1.5 99/07/05 SMIacomp: Sun WorkShop 6 update 1 C 5.2 2000/09/11cg: Sun WorkShop 6 update 1 Compiler Common 6.1 2000/09/11@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.68 02/06/10 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.66 01/01/17 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.25 98/06/30 SMI@(#)siginfo.h 1.54 98/03/27 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/02/14 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)libintl.h 1.12 97/08/20 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMIacomp: Sun WorkShop 6 update 1 C 5.2 2000/09/11cg: Sun WorkShop 6 update 1 Compiler Common 6.1 2000/09/11@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.68 02/06/10 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.66 01/01/17 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.25 98/06/30 SMI@(#)siginfo.h 1.54 98/03/27 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/02/14 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)signal.h 1.38 99/08/10 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal_iso.h 1.1 99/08/09 SMI@(#)signal.h 1.54 99/07/26 SMI@(#)libintl.h 1.12 97/08/20 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMIacomp: Sun WorkShop 6 update 1 C 5.2 2000/09/11cg: Sun WorkShop 6 update 1 Compiler Common 6.1 2000/09/11@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.68 02/06/10 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.66 01/01/17 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)libintl.h 1.12 97/08/20 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMIacomp: Sun WorkShop 6 update 1 C 5.2 2000/09/11cg: Sun WorkShop 6 update 1 Compiler Common 6.1 2000/09/11@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.68 02/06/10 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.66 01/01/17 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.25 98/06/30 SMI@(#)siginfo.h 1.54 98/03/27 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/02/14 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)libintl.h 1.12 97/08/20 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMIacomp: Sun WorkShop 6 update 1 C 5.2 2000/09/11cg: Sun WorkShop 6 update 1 Compiler Common 6.1 2000/09/11@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.68 02/06/10 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.66 01/01/17 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.25 98/06/30 SMI@(#)siginfo.h 1.54 98/03/27 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/02/14 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)libintl.h 1.12 97/08/20 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMIacomp: Sun WorkShop 6 update 1 C 5.2 2000/09/11cg: Sun WorkShop 6 update 1 Compiler Common 6.1 2000/09/11@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.68 02/06/10 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.66 01/01/17 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.25 98/06/30 SMI@(#)siginfo.h 1.54 98/03/27 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/02/14 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)libintl.h 1.12 97/08/20 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMIacomp: Sun WorkShop 6 update 1 C 5.2 2000/09/11cg: Sun WorkShop 6 update 1 Compiler Common 6.1 2000/09/11@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.68 02/06/10 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.66 01/01/17 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMIacomp: Sun WorkShop 6 update 1 C 5.2 2000/09/11cg: Sun WorkShop 6 update 1 Compiler Common 6.1 2000/09/11@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.68 02/06/10 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.66 01/01/17 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMIacomp: Sun WorkShop 6 update 1 C 5.2 2000/09/11cg: Sun WorkShop 6 update 1 Compiler Common 6.1 2000/09/11@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.68 02/06/10 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.66 01/01/17 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.25 98/06/30 SMI@(#)siginfo.h 1.54 98/03/27 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/02/14 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)libintl.h 1.12 97/08/20 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMIacomp: Sun WorkShop 6 update 1 C 5.2 2000/09/11cg: Sun WorkShop 6 update 1 Compiler Common 6.1 2000/09/11@(#)alloca.h 1.15 99/03/11 SMI@(#)types.h 1.68 02/06/10 SMI@(#)isa_defs.h 1.20 99/05/04 SMI@(#)feature_tests.h 1.18 99/07/26 SMI@(#)machtypes.h 1.13 99/05/04 SMI@(#)int_types.h 1.6 97/08/20 SMI@(#)select.h 1.16 98/04/27 SMI@(#)time.h 2.66 01/01/17 SMI@(#)time.h 1.39 99/08/10 SMI@(#)time_iso.h 1.1 99/08/09 SMI@(#)time_impl.h 1.5 99/10/05 SMI@(#)stdio.h 1.78 99/12/08 SMI@(#)stdio_iso.h 1.2 99/10/25 SMI@(#)va_list.h 1.12 99/05/04 SMI@(#)stdio_tag.h 1.3 98/04/20 SMI@(#)stdio_impl.h 1.8 99/06/10 SMI@(#)stdlib.h 1.47 99/11/03 SMI@(#)stdlib_iso.h 1.2 99/12/21 SMI@(#)wait.h 1.21 97/04/08 SMI@(#)resource.h 1.25 98/06/30 SMI@(#)siginfo.h 1.54 98/03/27 SMI@(#)machsig.h 1.15 99/08/15 SMI@(#)procset.h 1.20 00/02/14 SMI@(#)string.h 1.24 99/08/10 SMI@(#)string_iso.h 1.2 99/11/09 SMI@(#)unistd.h 1.58 99/11/11 SMI@(#)unistd.h 1.37 98/10/28 SMI@(#)mman.h 1.38 99/05/19 SMI@(#)pwd.h 1.19 96/03/12 SMI@(#)limits.h 1.51 99/10/08 SMI@(#)limits_iso.h 1.1 99/08/09 SMI@(#)int_limits.h 1.6 99/08/06 SMI@(#)utime.h 1.8 92/07/14 SMI@(#)utime.h 1.9 97/08/12 SMI@(#)errno.h 1.16 99/07/26 SMI@(#)errno.h 1.20 00/02/14 SMI@(#)fcntl.h 1.14 97/12/05 SMI@(#)stat.h 1.2 99/05/19 SMI@(#)stat_impl.h 1.1 99/05/04 SMI@(#)fcntl.h 1.45 98/07/17 SMI@(#)assert.h 1.9 92/07/14 SMI@(#)ioctl.h 1.9 92/07/14 SMI@(#)termios.h 1.6 92/07/14 SMI@(#)termios.h 1.38 98/02/20 SMI@(#)ttydev.h 1.7 92/07/14 SMI@(#)libintl.h 1.12 97/08/20 SMIacomp: Sun WorkShop 6 update 1 C 5.2 2000/09/11cg: Sun WorkShop 6 update 1 Compiler Common 6.1 2000/09/11acomp: Sun WorkShop 6 update 1 C 5.2 2000/09/11ld: Software Generation Utilities - Solaris Link Editors: 5.8-1.273.interp.hash.dynsym.dynstr.SUNW_version.rela.ex_shared.rela.cpp_finidata.rela.data.rela.bss.rela.plt.text.init.fini.exception_ranges.rodata.rodata1.got.plt.dynamic.ex_shared.cpp_finidata.data.data1.bss.symtab.strtab.stab.index.comment.shstrtab.stab.indexstr  t  \ \"##o44-B550 =B55  PB55  [B55$ eB55L o;H;HuCCP{DHDHDDDD JJ^VDDHH ( ,tt 6 hF